Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T03661
|
||||
| Former ID |
TTDS00092
|
||||
| Target Name |
Adenosine deaminase
|
||||
| Gene Name |
ADA
|
||||
| Synonyms |
Adenosine aminohydrolase; ADA
|
||||
| Target Type |
Successful
|
||||
| Disease | Chronic pain [ICD9: 338.2,780; ICD10: R52.1-R52.2, G89] | ||||
| Hairy cell leukemia [ICD9: 202.4; ICD10: C91.4] | |||||
| Hematological malignancies [ICD9: 200-209; ICD10: C81-C86] | |||||
| Immunodeficiency [ICD9: 279.3; ICD10: D84.9] | |||||
| Function |
Catalyzes the hydrolytic deamination of adenosine and 2- deoxyadenosine. Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4. Its interaction with DPP4 regulates lymphocyte- epithelial cell adhesion.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| Target Validation |
T03661
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.4.4
|
||||
| Sequence |
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG QNL |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Cladribine | Drug Info | Approved | Hairy cell leukemia | [468028], [536604] |
| Fludarabine | Drug Info | Approved | Hematological malignancies | [468033], [536361] | |
| Pentostatin | Drug Info | Approved | Hairy cell leukemia | [468036], [536361] | |
| GSK2696273 | Drug Info | Preregistration | Chronic pain | [549202] | |
| EZN-2279 | Drug Info | Phase 3 | Immunodeficiency | [523593] | |
| Ex vivo adenosine deaminase-transduced hematopoietic stem cell therapy | Drug Info | Phase 1/2 | Immunodeficiency | [551929] | |
| Inhibitor | (2S,3R)-3-(6-amino-9H-purin-9-yl)nonan-2-ol | Drug Info | [551374] | ||
| 1-Deaza-Adenosine | Drug Info | [551393] | |||
| 3-(6-Amino-purin-9-yl)-4-butoxy-butan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-4-p-tolyl-butan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-4-phenethyloxy-butan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-5-m-tolyl-pentan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-6-o-tolyl-hexan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-6-phenyl-hexan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-7-phenyl-heptan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-8-phenyl-octan-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-non-5-en-2-ol | Drug Info | [525926] | |||
| 3-(6-Amino-purin-9-yl)-non-5-yn-2-ol | Drug Info | [525926] | |||
| 6-Hydroxy-1,6-Dihydro Purine Nucleoside | Drug Info | [551393] | |||
| 6-Hydroxy-7,8-Dihydro Purine Nucleoside | Drug Info | [551393] | |||
| Cladribine | Drug Info | [535395], [536010] | |||
| EHNA | Drug Info | [534055] | |||
| Fludarabine | Drug Info | [535008] | |||
| FR117016 | Drug Info | [551374] | |||
| FR221647 | Drug Info | [551374] | |||
| FR230513 | Drug Info | [551374] | |||
| FR233623 | Drug Info | [551374] | |||
| FR236913 | Drug Info | [551374] | |||
| FR239087 | Drug Info | [551374] | |||
| Pentostatin | Drug Info | [535008], [538032] | |||
| Purine Riboside | Drug Info | [551393] | |||
| Modulator | Ex vivo adenosine deaminase-transduced hematopoietic stem cell therapy | Drug Info | [551928] | ||
| EZN-2279 | Drug Info | [551689] | |||
| GSK2696273 | Drug Info | [551928] | |||
| Pathways | |||||
| BioCyc Pathway | Purine nucleotides degradation | ||||
| Purine deoxyribonucleosides degradation | |||||
| Purine ribonucleosides degradation to ribose-1-phosphate | |||||
| Adenosine nucleotides degradation | |||||
| Superpathway of purine nucleotide salvage | |||||
| Adenine and adenosine salvage III | |||||
| KEGG Pathway | Purine metabolism | ||||
| Metabolic pathways | |||||
| Primary immunodeficiency | |||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| PANTHER Pathway | Adenine and hypoxanthine salvage pathway | ||||
| Pathway Interaction Database | p73 transcription factor network | ||||
| C-MYB transcription factor network | |||||
| Validated transcriptional targets of deltaNp63 isoforms | |||||
| Validated transcriptional targets of TAp63 isoforms | |||||
| PathWhiz Pathway | Purine Metabolism | ||||
| Reactome | Purine salvage | ||||
| WikiPathways | Metabolism of nucleotides | ||||
| References | |||||
| Ref 468028 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4799). | ||||
| Ref 468033 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4802). | ||||
| Ref 468036 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4805). | ||||
| Ref 523593 | ClinicalTrials.gov (NCT01420627) EZN-2279 in Patients With ADA-SCID. U.S. National Institutes of Health. | ||||
| Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
| Ref 536604 | Multiple sclerosis: current and future treatment options. Endocr Metab Immune Disord Drug Targets. 2007 Dec;7(4):292-9. | ||||
| Ref 525926 | J Med Chem. 2000 Nov 30;43(24):4694-700.Adenosine deaminase inhibitors: synthesis and biological evaluation of unsaturated, aromatic, and oxo derivatives of (+)-erythro-9-(2'S-hydroxy-3'R-nonyl)adenine [(+)-EHNA]. | ||||
| Ref 534055 | Tight-binding inhibitors--IV. Inhibition of adenosine deaminases by various inhibitors. Biochem Pharmacol. 1977 Mar 1;26(5):359-67. | ||||
| Ref 535008 | Purine nucleoside analogs in indolent non-Hodgkin's lymphoma. Oncology (Williston Park). 2000 Jun;14(6 Suppl 2):13-5. | ||||
| Ref 536010 | Cladribine: from the bench to the bedside--focus on hairy cell leukemia. Expert Rev Anticancer Ther. 2004 Oct;4(5):745-57. | ||||
| Ref 538032 | Acquisition of resistance to anticancer agents by overproduction of target enzymes. Nippon Rinsho. 1997 May;55(5):1030-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

