Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T35842
|
||||
Former ID |
TTDR00530
|
||||
Target Name |
Melanocyte stimulating hormone receptor
|
||||
Gene Name |
MC1R
|
||||
Synonyms |
MC1-R; MSH-R; Melanocortin-1 receptor; Melanotropin receptor; MC1R
|
||||
Target Type |
Clinical Trial
|
||||
Disease | Atopic dermatitis [ICD9: 691.8, 692.9; ICD10: L00-L99] | ||||
Metabolic disorders [ICD9: 270-279; ICD10: E70-E89] | |||||
Function |
Receptor for msh (alpha, beta and gamma) and acth. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T35842
|
||||
UniProt ID | |||||
Sequence |
MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF HSQELRRTLKEVLTCSW |
||||
Drugs and Mode of Action | |||||
Inhibitor | Ac-dR[CEHdFRWC]-NH2 | Drug Info | [527529] | ||
Ac-His-D-Phe-Arg-2-Nal-NHCH3 | Drug Info | [528247] | |||
Ac-His-DPhe-Arg-Trp-NH2 | Drug Info | [534420] | |||
Ac-Nle-c[Asp-His-DNaI(2')-Pro-Trp-Lys]-NH2 | Drug Info | [530169] | |||
Ac-Nle-c[Asp-His-DNal(2')-Pro-Trp-Lys]-NH2 | Drug Info | [530169] | |||
Ac-Nle-c[Asp-His-DPhe-Arg-Trp-Lys]-NH2 | Drug Info | [530169] | |||
Ac-R[CEHdFRWC]-NH2 | Drug Info | [527529] | |||
Ac-Tyr-D-Phe-Arg-2-Nal-NHCH3 | Drug Info | [528247] | |||
Ac-YCit[CEHdFRWC]-NH2 | Drug Info | [527529] | |||
Ac-YK[CEHdFRWC]-NH2 | Drug Info | [527529] | |||
Ac-YRC(Me)*EHdFRWC(Me)NH2 | Drug Info | [527529] | |||
Ac-YRMEHdFRWG-NH2 | Drug Info | [527529] | |||
Ac-YRMEHdFRWGSPPKD-NH2 | Drug Info | [527529] | |||
Ac-YR[CEH(d-2alpha-Nal)RWC]-NH2 | Drug Info | [527529] | |||
Ac-YR[CEH(pCl-dF)RWC]-NH2 | Drug Info | [527529] | |||
Ac-YR[CEH(pF-dF)RWC]-NH2 | Drug Info | [527529] | |||
Ac-YR[CEHdFRWC]-NH2 | Drug Info | [527529] | |||
Ac-YR[CEHdFRWC]SPPKD-NH2 | Drug Info | [527529] | |||
Ac-YR[CEHFRWC]-NH2 | Drug Info | [527529] | |||
Ac-[CEHdFRWC]-NH2 | Drug Info | [527529] | |||
AEKKDEGPYRMEHFRWGSPPKD | Drug Info | [527529] | |||
C[CO-(CH2)2-CO-Nle-D-Nal(2)-Arg-Trp-Lys]-NH2 | Drug Info | [529226] | |||
C[CO-2,3-pyrazine-CO-D-Nal(2)-Arg-Trp-Lys]-NH2 | Drug Info | [529226] | |||
C[CO-2,3-pyrazine-CO-D-Phe-Arg-Trp-Lys]-NH2 | Drug Info | [529226] | |||
C[CO-o-C6H4-CO-Pro-D-Nal(2)-Arg-Trp-Lys]-NH2 | Drug Info | [529226] | |||
C[Nle-Arg-D-Nal(2')-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
C[Nle-Arg-D-Phe-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
C[Nle-Gln-D-Nal(2')-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
C[Nle-Gln-D-Phe-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
C[Nle-Nle-D-Nal(2')-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
C[Nle-Val-D-Nal(2')-Arg-Trp-Glu]-NH2 | Drug Info | [528082] | |||
D-Phe-Arg-2-Nal-NHCH3 | Drug Info | [528325] | |||
GPYRMEHFRWGSPPKD-NH2 | Drug Info | [527529] | |||
NDP-SYSMEHFRWGKPVG | Drug Info | [527529] | |||
Tic-D-Phe-Arg-2-Nal-NHCH3 | Drug Info | [527941] | |||
Modulator | afamelanotide | Drug Info | [1572605] | ||
AP-1030 | Drug Info | [1572591] | |||
AP-1189 | Drug Info | [543719] | |||
Agonist | MT-II | Drug Info | [533012] | ||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
References | |||||
Ref 527529 | J Med Chem. 2005 May 5;48(9):3095-8.Discovery of a beta-MSH-derived MC-4R selective agonist. | ||||
Ref 527941 | Bioorg Med Chem Lett. 2006 Mar 15;16(6):1721-5. Epub 2005 Dec 20.Synthesis of Tic-D-Phe Psi[CH2-CH2] isostere and its use in the development of melanocortin receptor agonists. | ||||
Ref 528082 | J Med Chem. 2006 Mar 23;49(6):1946-52.Development of cyclic gamma-MSH analogues with selective hMC3R agonist and hMC3R/hMC5R antagonist activities. | ||||
Ref 528247 | Bioorg Med Chem Lett. 2006 Sep 1;16(17):4668-73.Design and synthesis of potent and selective 1,3,4-trisubstituted-2-oxopiperazine based melanocortin-4 receptor agonists. | ||||
Ref 528325 | J Med Chem. 2006 Jul 27;49(15):4745-61.Design, synthesis, and evaluation of proline and pyrrolidine based melanocortin receptor agonists. A conformationally restricted dipeptide mimic approach. | ||||
Ref 529226 | J Med Chem. 2008 Jan 24;51(2):187-95. Epub 2007 Dec 19.Structure-activity relationships of cyclic lactam analogues of alpha-melanocyte-stimulating hormone (alpha-MSH) targeting the human melanocortin-3 receptor. | ||||
Ref 530169 | J Med Chem. 2009 Jun 25;52(12):3627-35.Substitution of arginine with proline and proline derivatives in melanocyte-stimulating hormones leads to selectivity for human melanocortin 4 receptor. | ||||
Ref 533012 | Design of potent linear alpha-melanotropin 4-10 analogues modified in positions 5 and 10. J Med Chem. 1989 Jan;32(1):174-9. | ||||
Ref 534420 | J Med Chem. 1997 Jul 4;40(14):2133-9.Discovery of prototype peptidomimetic agonists at the human melanocortin receptors MC1R and MC4R. | ||||
Ref 543719 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 282). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.