Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T38012
|
||||
Former ID |
TTDI02593
|
||||
Target Name |
Potassium channel KCNJ3 Kir3.1
|
||||
Gene Name |
KCNJ3
|
||||
Synonyms |
G proteinactivated inward rectifier potassium channel 1; GIRK1; Inward rectifier K(+) channel Kir3.1; Potassium channel, inwardly rectifying subfamily J member 3; KCNJ3
|
||||
Target Type |
Research
|
||||
Function |
This potassium channel is controlled byG proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This receptor plays a crucial role in regulating the heartbeat.
|
||||
BioChemical Class |
Inward rectifier K(+) channel
|
||||
UniProt ID | |||||
Sequence |
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG AARMEGNLPAKLRKMNSDRFT |
||||
Pathways | |||||
KEGG Pathway | Circadian entrainment | ||||
Retrograde endocannabinoid signaling | |||||
Glutamatergic synapse | |||||
Cholinergic synapse | |||||
Serotonergic synapse | |||||
Dopaminergic synapse | |||||
Estrogen signaling pathway | |||||
Oxytocin signaling pathway | |||||
Morphine addiction | |||||
PANTHER Pathway | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | ||||
Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
GABA-B receptor II signaling | |||||
PathWhiz Pathway | Muscle/Heart Contraction | ||||
Reactome | Activation of G protein gated Potassium channels | ||||
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits | |||||
WikiPathways | Calcium Regulation in the Cardiac Cell | ||||
G Protein Signaling Pathways | |||||
Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
Potassium Channels | |||||
References |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.