Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T46185
|
||||
Former ID |
TTDS00003
|
||||
Target Name |
Muscarinic acetylcholine receptor M2
|
||||
Gene Name |
CHRM2
|
||||
Synonyms |
M2 receptor; CHRM2
|
||||
Target Type |
Successful
|
||||
Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
Asthma [ICD10: J45] | |||||
Cardiovascular disorder [ICD10: I00-I99] | |||||
Glaucoma [ICD9: 365; ICD10: H40-H42] | |||||
Heart failure [ICD9: 428; ICD10: I50] | |||||
Nausea; Addiction [ICD9: 303-305, 787.0; ICD10: F10-F19, R11] | |||||
Overactive bladder disorder [ICD9: 188, 596.51; ICD10: C67, N32.81] | |||||
Peptic ulcer [ICD9: 531-534; ICD10: K25-K27] | |||||
Parkinson's disease [ICD9: 332; ICD10: G20] | |||||
Stabilize muscle contractions [ICD10: M00-M99] | |||||
Seborrhea [ICD10: L21] | |||||
Urinary incontinence [ICD9: 788.3; ICD10: N39.3, N39.4, R32] | |||||
Unspecified [ICD code not available] | |||||
Function |
The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is adenylate cyclase inhibition. Signaling promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3); this then triggers calcium ion release into the cytosol.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T46185
|
||||
UniProt ID | |||||
Sequence |
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL |
||||
Structure |
1LUB; 3UON; 4MQS; 4MQT
|
||||
Drugs and Mode of Action | |||||
Drug(s) | ACECLIDINE | Drug Info | Approved | Glaucoma | [539906], [551871] |
Gallamine Triethiodide | Drug Info | Approved | Stabilize muscle contractions | [550753] | |
METHACHOLINE | Drug Info | Approved | Asthma | [526519], [530155], [533484], [542461], [551871] | |
Methylscopolamine | Drug Info | Approved | Peptic ulcer | [540146], [550719], [551871] | |
Scopolamine | Drug Info | Approved | Nausea; Addiction | [540261], [551436] | |
SMT-D002 | Drug Info | Approved | Seborrhea | [551707] | |
FP-1097 | Drug Info | Phase 2 | Urinary incontinence | [547822] | |
Otenzepad | Drug Info | Discontinued in Phase 2 | Heart failure | [540091], [544816] | |
PSD-506 | Drug Info | Discontinued in Phase 2 | Overactive bladder disorder | [548196] | |
SCH-211803 | Drug Info | Discontinued in Phase 1 | Parkinson's disease | [547376] | |
Alvameline | Drug Info | Terminated | Alzheimer disease | [534674] | |
AQ-RA-741 | Drug Info | Terminated | Cardiovascular disorder | [543206], [545137] | |
BIBN-140 | Drug Info | Terminated | Alzheimer disease | [534038] | |
BIBN-99 | Drug Info | Terminated | Alzheimer disease | [545083] | |
HIMBACINE | Drug Info | Terminated | Discovery agent | [540212], [546219] | |
Sch-57790 | Drug Info | Terminated | Alzheimer disease | [540439], [546916] | |
Antagonist | (R)-4-[2-[3-(4-methoxy-benzoylamino)-benzyl]-piperidin-1-ylmethyl]piperidine-1-carboxylic acid amide (Ro-320-6206) | Drug Info | [535357], [535903] | ||
FP-1097 | Drug Info | [549828] | |||
Gallamine Triethiodide | Drug Info | [535420] | |||
Methylscopolamine | Drug Info | [537554] | |||
Otenzepad | Drug Info | [535357] | |||
Sch-57790 | Drug Info | [525433] | |||
Scopolamine | Drug Info | [536730], [537137] | |||
Inhibitor | 1'-Benzyl-3-phenyl-[3,4']bipiperidinyl-2,6-dione | Drug Info | [533345] | ||
1,1-diphenyl-2-(3-tropanyl)ethanol | Drug Info | [530266] | |||
1-Methyl-1-(4-pyrrolidin-1-yl-but-2-ynyl)-urea | Drug Info | [527029] | |||
2,8-Dimethyl-1-oxa-8-aza-spiro[4.5]decan-3-one | Drug Info | [534723] | |||
2-(4-Diethylamino-but-2-ynyl)-isoindole-1,3-dione | Drug Info | [551341] | |||
2-Methyl-6-pyrrolidin-1-yl-hex-4-ynal oxime | Drug Info | [551235] | |||
3-(3-benzylamino)-piperidin-2-one | Drug Info | [528735] | |||
3-Methyl-7-pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [551235] | |||
3-Tetrazol-2-yl-1-aza-bicyclo[2.2.2]octane | Drug Info | [527344] | |||
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
6-Dimethylamino-2-methyl-hex-4-ynal oxime | Drug Info | [551235] | |||
7-Dimethylamino-3-methyl-hept-5-yn-2-one | Drug Info | [551235] | |||
7-Dimethylamino-hept-5-yn-2-one | Drug Info | [551235] | |||
7-Pyrrolidin-1-yl-hept-5-yn-2-one | Drug Info | [551235] | |||
A-987306 | Drug Info | [529789] | |||
ACECLIDINE | Drug Info | [534044] | |||
Acetic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [534645] | |||
Benzoic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [525826] | |||
BRL-55473 | Drug Info | [551234] | |||
CARAMIPEN | Drug Info | [529957] | |||
FLUMEZAPINE | Drug Info | [533165] | |||
FM1-10 | Drug Info | [529178] | |||
FM1-43 | Drug Info | [529178] | |||
GNF-PF-5618 | Drug Info | [527653] | |||
HIMBACINE | Drug Info | [527126] | |||
ISOCLOZAPINE | Drug Info | [530313] | |||
ISOLOXAPINE | Drug Info | [533577] | |||
METHACHOLINE | Drug Info | [534645] | |||
METHOCTRAMINE | Drug Info | [529789] | |||
N-(4-Dimethylamino-but-2-ynyl)-N-methyl-acetamide | Drug Info | [551235] | |||
N-methoxyquinuclidine-3-carboximidoyl chloride | Drug Info | [551234] | |||
N-methoxyquinuclidine-3-carboximidoyl fluoride | Drug Info | [551234] | |||
Propionic acid 8-aza-bicyclo[3.2.1]oct-6-yl ester | Drug Info | [525826] | |||
SCH-211803 | Drug Info | [526473] | |||
SULFOARECOLINE | Drug Info | [533450] | |||
Modulator | AF-DX-384 | Drug Info | |||
Alvameline | Drug Info | [534674] | |||
AQ-RA-741 | Drug Info | [533924] | |||
BIBN-140 | Drug Info | [534038] | |||
BIBN-99 | Drug Info | [533931] | |||
PSD-506 | Drug Info | [1572591] | |||
Agonist | CMI-1145 | Drug Info | [535589] | ||
CMI-936 | Drug Info | [535589] | |||
Oxotremorine | Drug Info | [535589] | |||
PTAC | Drug Info | [535182] | |||
SMT-D002 | Drug Info | [527286] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
cAMP signaling pathway | |||||
Neuroactive ligand-receptor interaction | |||||
PI3K-Akt signaling pathway | |||||
Cholinergic synapse | |||||
Regulation of actin cytoskeleton | |||||
PANTHER Pathway | Alzheimer disease-amyloid secretase pathway | ||||
Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
PathWhiz Pathway | Muscle/Heart Contraction | ||||
Reactome | Muscarinic acetylcholine receptors | ||||
G alpha (i) signalling events | |||||
WikiPathways | SIDS Susceptibility Pathways | ||||
Monoamine GPCRs | |||||
Calcium Regulation in the Cardiac Cell | |||||
Regulation of Actin Cytoskeleton | |||||
GPCRs, Class A Rhodopsin-like | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
GPCRs, Other | |||||
References | |||||
Ref 526519 | Muscarinic M3-receptors mediate cholinergic synergism of mitogenesis in airway smooth muscle. Am J Respir Cell Mol Biol. 2003 Feb;28(2):257-62. | ||||
Ref 530155 | Muscarinic M3 receptor stimulation increases cigarette smoke-induced IL-8 secretion by human airway smooth muscle cells. Eur Respir J. 2009 Dec;34(6):1436-43. | ||||
Ref 533484 | Dissociation constants and relative efficacies of acetylcholine, (+)- and (-)-methacholine at muscarinic receptors in the guinea-pig ileum. Br J Pharmacol. 1986 Sep;89(1):7-13. | ||||
Ref 534038 | Therapeutic potential of CNS-active M2 antagonists: novel structures and pharmacology. Life Sci. 1993;52(5-6):497-503. | ||||
Ref 534674 | In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40. | ||||
Ref 539906 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 288). | ||||
Ref 540091 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 309). | ||||
Ref 540146 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 316). | ||||
Ref 540212 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 324). | ||||
Ref 540261 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 330). | ||||
Ref 540439 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 350). | ||||
Ref 542461 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7438). | ||||
Ref 543206 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8584). | ||||
Ref 544816 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001216) | ||||
Ref 545083 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002066) | ||||
Ref 545137 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002261) | ||||
Ref 546219 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006949) | ||||
Ref 546916 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011087) | ||||
Ref 547376 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015639) | ||||
Ref 547822 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019662) | ||||
Ref 525826 | J Med Chem. 2000 Jun 29;43(13):2514-22.6beta-Acyloxy(nor)tropanes: affinities for antagonist/agonist binding sites on transfected and native muscarinic receptors. | ||||
Ref 526473 | J Med Chem. 2002 Dec 5;45(25):5415-8.Improving the oral efficacy of CNS drug candidates: discovery of highly orally efficacious piperidinyl piperidine M2 muscarinic receptor antagonists. | ||||
Ref 527029 | J Med Chem. 1992 Aug 21;35(17):3270-9.Urea and 2-imidazolidone derivatives of the muscarinic agents oxotremorine and N-methyl-N-(1-methyl-4-pyrrolidino-2-butynyl)acetamide. | ||||
Ref 527126 | Bioorg Med Chem Lett. 2004 Aug 2;14(15):3967-70.Himbacine analogs as muscarinic receptor antagonists--effects of tether and heterocyclic variations. | ||||
Ref 527286 | Demonstration of bladder selective muscarinic receptor binding by intravesical oxybutynin to treat overactive bladder. J Urol. 2004 Nov;172(5 Pt 1):2059-64. | ||||
Ref 527344 | J Med Chem. 1992 Apr 3;35(7):1280-90.Synthesis and muscarinic activities of quinuclidin-3-yltriazole and -tetrazole derivatives. | ||||
Ref 527653 | J Nat Prod. 2005 Jul;68(7):1061-5.Nocardimicins A, B, C, D, E, and F, siderophores with muscarinic M3 receptor inhibiting activity from Nocardia sp. TP-A0674. | ||||
Ref 528735 | J Med Chem. 2007 Apr 19;50(8):1925-32. Epub 2007 Mar 17.Designing active template molecules by combining computational de novo design and human chemist's expertise. | ||||
Ref 529178 | Bioorg Med Chem Lett. 2008 Jan 15;18(2):825-7. Epub 2007 Nov 17.Design and synthesis of a fluorescent muscarinic antagonist. | ||||
Ref 529789 | J Med Chem. 2008 Nov 27;51(22):7094-8.cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain responses against carrageenan-induced hyperalgesia. | ||||
Ref 529957 | J Med Chem. 1991 Oct;34(10):2984-9.Muscarinic receptor binding profile of para-substituted caramiphen analogues. | ||||
Ref 530266 | Bioorg Med Chem Lett. 2009 Aug 15;19(16):4560-2. Epub 2009 Jul 8.Discovery of (3-endo)-3-(2-cyano-2,2-diphenylethyl)-8,8-dimethyl-8-azoniabicyclo[3.2.1]octane bromide as an efficacious inhaled muscarinic acetylcholine receptor antagonist for the treatment of COPD. | ||||
Ref 530313 | J Med Chem. 1990 Feb;33(2):809-14.Chloro-substituted, sterically hindered 5,11-dicarbo analogues of clozapine as potential chiral antipsychotic agents. | ||||
Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
Ref 533165 | J Med Chem. 1989 Dec;32(12):2573-82.Synthesis and pharmacological evaluation of a series of 4-piperazinylpyrazolo[3,4-b]- and -[4,3-b][1,5]benzodiazepines as potential anxiolytics. | ||||
Ref 533345 | J Med Chem. 1989 May;32(5):1057-62.Synthesis and biological evaluation of [125I]- and [123I]-4-iododexetimide, a potent muscarinic cholinergic receptor antagonist. | ||||
Ref 533450 | J Med Chem. 1988 Jul;31(7):1312-6.Heterocyclic muscarinic agonists. Synthesis and biological activity of some bicyclic sulfonium arecoline bioisosteres. | ||||
Ref 533577 | J Med Chem. 1981 Sep;24(9):1021-6.Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. | ||||
Ref 533924 | Pharmacological profile of selective muscarinic receptor antagonists on guinea-pig ileal smooth muscle. Eur J Pharmacol. 1994 Mar 3;253(3):275-81. | ||||
Ref 533931 | Characterization of BIBN 99: a lipophilic and selective muscarinic M2 receptor antagonist. Eur J Pharmacol. 1993 Sep 21;242(1):23-30. | ||||
Ref 534038 | Therapeutic potential of CNS-active M2 antagonists: novel structures and pharmacology. Life Sci. 1993;52(5-6):497-503. | ||||
Ref 534044 | J Med Chem. 1993 Apr 2;36(7):842-7.Design, synthesis, and neurochemical evaluation of 5-(3-alkyl-1,2,4- oxadiazol-5-yl)-1,4,5,6-tetrahydropyrimidines as M1 muscarinic receptor agonists. | ||||
Ref 534645 | J Med Chem. 1998 Jun 4;41(12):2047-55.6beta-Acetoxynortropane: a potent muscarinic agonist with apparent selectivity toward M2-receptors. | ||||
Ref 534674 | In vivo muscarinic cholinergic mediated effects of Lu 25-109, a M1 agonist and M2/M3 antagonist in vitro. Psychopharmacology (Berl). 1998 Jun;137(3):233-40. | ||||
Ref 534723 | J Med Chem. 1998 Oct 22;41(22):4181-5.Synthesis and modeling studies of a potent conformationally rigid muscarinic agonist: 1-azabicyclo[2.2.1]heptanespirofuranone. | ||||
Ref 535182 | Function of pulmonary neuronal M(2) muscarinic receptors in stable chronic obstructive pulmonary disease. Am J Respir Crit Care Med. 2001 May;163(6):1320-5. | ||||
Ref 535357 | Beneficial effect of muscarinic-2 antagonist on dilated cardiomyopathy induced by autoimmune mechanism against muscarinic-2 receptor. J Cardiovasc Pharmacol. 2001 Oct;38 Suppl 1:S43-9. | ||||
Ref 535420 | Cholinergic regulation of the corpora allata in adult male loreyi leafworm Mythimna loreyi. Arch Insect Biochem Physiol. 2002 Apr;49(4):215-24. | ||||
Ref 535589 | Evaluation of muscarinic agonist-induced analgesia in muscarinic acetylcholine receptor knockout mice. Mol Pharmacol. 2002 Nov;62(5):1084-93. | ||||
Ref 535903 | Signal transduction underlying carbachol-induced contraction of human urinary bladder. J Pharmacol Exp Ther. 2004 Jun;309(3):1148-53. Epub 2004 Feb 9. | ||||
Ref 536730 | Midbrain acetylcholine and glutamate receptors modulate accumbal dopamine release. Neuroreport. 2008 Jun 11;19(9):991-5. | ||||
Ref 537137 | The amygdala modulates morphine-induced state-dependent memory retrieval via muscarinic acetylcholine receptors. Neuroscience. 2009 May 5;160(2):255-63. Epub 2009 Mar 9. | ||||
Ref 551234 | A novel and selective class of azabicyclic muscarinic agonists incorporating an N-methoxy imidoyl halide or nitrile functionality, Bioorg. Med. Chem. Lett. 2(8):791-796 (1992). | ||||
Ref 551235 | Cholinergic agents: aldehyde, ketone, and oxime analogues of the muscarinic agonist UH5, Bioorg. Med. Chem. Lett. 2(8):803-808 (1992). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.