Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T56175
|
||||
Former ID |
TTDR00866
|
||||
Target Name |
Lanosterol synthase
|
||||
Gene Name |
LSS
|
||||
Synonyms |
2,3-epoxysqualene--lanosterol cyclase; OSC; Oxidosqualene cyclase; Oxidosqualene--lanosterol cyclase; LSS
|
||||
Target Type |
Discontinued
|
||||
Disease | Arteriosclerosis [ICD9: 440; ICD10: I70] | ||||
Function |
Catalyzes the cyclization of (S)-2,3 oxidosqualene to lanosterol, a reaction that forms the sterol nucleus.
|
||||
BioChemical Class |
Intramolecular transferases
|
||||
Target Validation |
T56175
|
||||
UniProt ID | |||||
EC Number |
EC 5.4.99.7
|
||||
Sequence |
MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDT
KNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLP AGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNIL HKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPM SYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYALL NLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAFQE HVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPR ERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQA LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYLQSAQSQIHNTCWAMMGLM AVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFS QLYPERALAGHP |
||||
Drugs and Mode of Action | |||||
Inhibitor | 29-methylidene-2,3-oxidosqualene | Drug Info | [534308] | ||
B-Octylglucoside | Drug Info | [551393] | |||
compound 1 | Drug Info | [531884] | |||
compound 1 (Gotteland et al., 1997) | Drug Info | [543630] | |||
compound 10 | Drug Info | [531884] | |||
compound 3 | Drug Info | [531884] | |||
compound 3 | Drug Info | [534308] | |||
compound 4 | Drug Info | [531884] | |||
compound 4 | Drug Info | [534308] | |||
compound 4a (Marquart et al., 1994) | Drug Info | [543630] | |||
compound 4b (Marquart et al., 1994) | Drug Info | [543630] | |||
compound 5 | Drug Info | [531884] | |||
compound 6 | Drug Info | [531884] | |||
compound 7 | Drug Info | [531884] | |||
compound 8 | Drug Info | [531884] | |||
compound 9 | Drug Info | [531884] | |||
Lanosterol | Drug Info | [551393] | |||
R048-8071 | Drug Info | [551393] | |||
Ro48-8071 | Drug Info | [535462] | |||
Tetradecane | Drug Info | [551393] | |||
[3-(Biphenyl-4-yloxy)-propyl]-dimethyl-amine | Drug Info | [526789] | |||
Modulator | BIBB-515 | Drug Info | [526088], [534359] | ||
BIBX-79 | Drug Info | [526088], [534217] | |||
ZD-9720 | Drug Info | [526088] | |||
Pathways | |||||
BioCyc Pathway | Cholesterol biosynthesis II (via 24,25-dihydrolanosterol) | ||||
Cholesterol biosynthesis III (via desmosterol) | |||||
Cholesterol biosynthesis I | |||||
Superpathway of cholesterol biosynthesis | |||||
Lanosterol biosynthesis | |||||
KEGG Pathway | Steroid biosynthesis | ||||
Metabolic pathways | |||||
Biosynthesis of antibiotics | |||||
PANTHER Pathway | Cholesterol biosynthesis | ||||
PathWhiz Pathway | Steroid Biosynthesis | ||||
Reactome | Cholesterol biosynthesis | ||||
Activation of gene expression by SREBF (SREBP) | |||||
WikiPathways | Activation of Gene Expression by SREBP (SREBF) | ||||
SREBP signalling | |||||
Cholesterol Biosynthesis | |||||
Cholesterol biosynthesis | |||||
References | |||||
Ref 526088 | Toxicologic lesions associated with two related inhibitors of oxidosqualene cyclase in the dog and mouse. Toxicol Pathol. 2001 Mar-Apr;29(2):174-9. | ||||
Ref 534217 | Effects of a novel 2,3-oxidosqualene cyclase inhibitor on the regulation of cholesterol biosynthesis in HepG2 cells. J Lipid Res. 1996 Jan;37(1):148-58. | ||||
Ref 534359 | Effects of a novel 2,3-oxidosqualene cyclase inhibitor on cholesterol biosynthesis and lipid metabolism in vivo. J Lipid Res. 1997 Mar;38(3):564-75. | ||||
Ref 526088 | Toxicologic lesions associated with two related inhibitors of oxidosqualene cyclase in the dog and mouse. Toxicol Pathol. 2001 Mar-Apr;29(2):174-9. | ||||
Ref 526789 | J Med Chem. 2003 Sep 25;46(20):4240-3.Oxidosqualene cyclase inhibitors as antimicrobial agents. | ||||
Ref 531884 | Cytotoxic effects of combination of oxidosqualene cyclase inhibitors with atorvastatin in human cancer cells. J Med Chem. 2012 Jun 14;55(11):4990-5002. | ||||
Ref 534217 | Effects of a novel 2,3-oxidosqualene cyclase inhibitor on the regulation of cholesterol biosynthesis in HepG2 cells. J Lipid Res. 1996 Jan;37(1):148-58. | ||||
Ref 534308 | Synthesis and inhibition studies of sulfur-substituted squalene oxide analogues as mechanism-based inhibitors of 2,3-oxidosqualene-lanosterol cyclase. J Med Chem. 1997 Jan 17;40(2):201-9. | ||||
Ref 534359 | Effects of a novel 2,3-oxidosqualene cyclase inhibitor on cholesterol biosynthesis and lipid metabolism in vivo. J Lipid Res. 1997 Mar;38(3):564-75. | ||||
Ref 535462 | Crystal structure of a squalene cyclase in complex with the potential anticholesteremic drug Ro48-8071. Chem Biol. 2002 May;9(5):639-45. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.