Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T62193
|
||||
| Former ID |
TTDS00361
|
||||
| Target Name |
Aromatic-L-amino-acid decarboxylase
|
||||
| Gene Name |
DDC
|
||||
| Synonyms |
AADC; DOPA decarboxylase; DDC
|
||||
| Target Type |
Successful
|
||||
| Disease | Parkinson's disease [ICD9: 332; ICD10: G20] | ||||
| Vitamin B6 deficiency [ICD9: 266.1; ICD10: E53.1] | |||||
| Function |
Catalyzes the decarboxylation of L-3,4- dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
|
||||
| BioChemical Class |
Carbon-carbon lyase
|
||||
| Target Validation |
T62193
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.1.1.28
|
||||
| Sequence |
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Carbidopa | Drug Info | Approved | Parkinson's disease | [468222], [536121] |
| Vitamin B6 | Drug Info | Approved | Vitamin B6 deficiency | [538432], [551871] | |
| Benserazide | Drug Info | Phase 3 | Discovery agent | [468214], [521673] | |
| Patrome | Drug Info | Phase 3 | Parkinson's disease | [529140] | |
| AV-201 | Drug Info | Phase 2 | Parkinson's disease | [551892] | |
| ProSavin | Drug Info | Phase 1/2 | Parkinson's disease | [524296] | |
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Superpathway of tryptophan utilization | ||||
| Tryptophan degradation via tryptamine | |||||
| Serotonin and melatonin biosynthesis | |||||
| Catecholamine biosynthesis | |||||
| KEGG Pathway | Histidine metabolism | ||||
| Tyrosine metabolism | |||||
| Phenylalanine metabolism | |||||
| Tryptophan metabolism | |||||
| Metabolic pathways | |||||
| Serotonergic synapse | |||||
| Dopaminergic synapse | |||||
| Cocaine addiction | |||||
| Amphetamine addiction | |||||
| Alcoholism | |||||
| PANTHER Pathway | Adrenaline and noradrenaline biosynthesis | ||||
| 5-Hydroxytryptamine biosynthesis | |||||
| Dopamine receptor mediated signaling pathway | |||||
| Nicotine pharmacodynamics pathway | |||||
| PathWhiz Pathway | Catecholamine Biosynthesis | ||||
| Tyrosine Metabolism | |||||
| Tryptophan Metabolism | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Biogenic Amine Synthesis | |||||
| Tryptophan metabolism | |||||
| Dopaminergic Neurogenesis | |||||
| Metabolism of amino acids and derivatives | |||||
| Dopamine metabolism | |||||
| Parkinsons Disease Pathway | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 468214 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5150). | ||||
| Ref 468222 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5159). | ||||
| Ref 521673 | ClinicalTrials.gov (NCT00144209) Assess Efficacy and Safety of the Dopamine Agonist Pramipexole Versus Levodopa / Benserazide (Madopar DR) in Patients With Restless Legs Syndrome. U.S. National Institutes of Health. | ||||
| Ref 524296 | ClinicalTrials.gov (NCT01856439) Long Term Safety and Efficacy Study of ProSavin in Parkinson's Disease. U.S. National Institutes of Health. | ||||
| Ref 529140 | Dopamine dysregulation syndrome, addiction and behavioral changes in Parkinson's disease. Parkinsonism Relat Disord. 2008;14(4):273-80. Epub 2007 Nov 7. | ||||
| Ref 536121 | Emerging drugs for restless legs syndrome. Expert Opin Emerg Drugs. 2005 Aug;10(3):537-52. | ||||
| Ref 538432 | FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010598. | ||||
| Ref 525931 | Clin Cancer Res. 2000 Nov;6(11):4365-72.The aromatic-L-amino acid decarboxylase inhibitor carbidopa is selectively cytotoxic to human pulmonary carcinoid and small cell lung carcinoma cells. | ||||
| Ref 535173 | Catechol-O-methyltransferase inhibitors in the management of Parkinson's disease. Semin Neurol. 2001;21(1):15-22. | ||||
| Ref 535831 | Activation of an adrenergic pro-drug through sequential stereoselective action of tandem target enzymes. Biochem Biophys Res Commun. 1992 Nov 30;189(1):33-9. | ||||
| Ref 536101 | Functional COMT variant predicts response to high dose pyridoxine in Parkinson's disease. Am J Med Genet B Neuropsychiatr Genet. 2005 Aug 5;137B(1):1-4. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

