Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T70967
|
||||
| Former ID |
TTDS00141
|
||||
| Target Name |
Neuronal acetylcholine receptor protein, alpha-4 chain
|
||||
| Gene Name |
CHRNA4
|
||||
| Synonyms |
Alpha-4 nAChR; Nicotinic acetylcholine receptor alpha4; CHRNA4
|
||||
| Target Type |
Successful
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Hypertensive emergencies; Aneurysm [ICD9:401-405; ICD10: I10, I72] | |||||
| Hypotension [ICD9: 458, 796.3; ICD10: I95] | |||||
| Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasmamembrane permeable to sodium ions.
|
||||
| BioChemical Class |
Neurotransmitter receptor
|
||||
| Target Validation |
T70967
|
||||
| UniProt ID | |||||
| Sequence |
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR IFLWMFIIVCLLGTVGLFLPPWLAGMI |
||||
| Structure |
2GVT; 2LLY
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Pentolinium | Drug Info | Approved | Hypotension | [550664] |
| Trimethaphan | Drug Info | Approved | Hypertensive emergencies; Aneurysm | [550667], [551871] | |
| ABT-418 | Drug Info | Discontinued in Phase 2 | Alzheimer disease | [545652] | |
| ABT-594 | Drug Info | Discontinued in Phase 2 | Discovery agent | [540604], [546684] | |
| HOMOEPIBATIDINE | Drug Info | Terminated | Discovery agent | [546333] | |
| Inhibitor | (2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | ||
| (2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | |||
| 3-[2-(N,N,N-trimethylammonium)ethoxy]pyridine | Drug Info | [528245] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 6'-methylepibatidine | Drug Info | [529145] | |||
| BOLDINE | Drug Info | [528761] | |||
| CMI-489 | Drug Info | [529145] | |||
| CYTISINE | Drug Info | [528394] | |||
| HOMOEPIBATIDINE | Drug Info | [528394] | |||
| N,N-dimethyl(pyridin-3-yl)methanamine | Drug Info | [527965] | |||
| N,N-dimethyl-2-(pyridin-3-yloxy)ethanamine | Drug Info | [527965] | |||
| N,N-dimethyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-ethyl-N-methyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-methyl-2-(pyridin-3-yloxy)ethanamine | Drug Info | [527965] | |||
| N-methyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-methyl-N-(pyridin-3-ylmethyl)ethanamine | Drug Info | [527965] | |||
| Predicentrine methiodide | Drug Info | [528761] | |||
| Agonist | ABT-418 | Drug Info | [537889] | ||
| ABT-594 | Drug Info | [534971] | |||
| Antagonist | Barbituric acid derivative | Drug Info | [551407] | ||
| Pentolinium | Drug Info | [537945] | |||
| Trimethaphan | Drug Info | [537901] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Cholinergic synapse | |||||
| Nicotine addiction | |||||
| PANTHER Pathway | Nicotinic acetylcholine receptor signaling pathway | ||||
| Nicotine pharmacodynamics pathway | |||||
| Reactome | Highly sodium permeable acetylcholine nicotinic receptors | ||||
| Highly calcium permeable postsynaptic nicotinic acetylcholine receptors | |||||
| Highly calcium permeable nicotinic acetylcholine receptors | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 540604 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3989). | ||||
| Ref 545652 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004036) | ||||
| Ref 546333 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007531) | ||||
| Ref 527965 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):2013-6. Epub 2006 Jan 18.Synthesis and analgesic activity of secondary amine analogues of pyridylmethylamine and positional isomeric analogues of ABT-594. | ||||
| Ref 528245 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4283-6. Epub 2006 Jun 9.Aryloxyethylamines: binding at alpha7 nicotinic acetylcholine receptors. | ||||
| Ref 528394 | Bioorg Med Chem Lett. 2006 Nov 1;16(21):5493-7. Epub 2006 Aug 28.Epibatidine isomers and analogues: structure-activity relationships. | ||||
| Ref 528761 | Bioorg Med Chem. 2007 May 15;15(10):3368-72. Epub 2007 Mar 13.Aporphine metho salts as neuronal nicotinic acetylcholine receptor blockers. | ||||
| Ref 529145 | J Med Chem. 2007 Dec 13;50(25):6383-91. Epub 2007 Nov 10.Synthesis and nicotinic acetylcholine receptor binding properties of bridged and fused ring analogues of epibatidine. | ||||
| Ref 530946 | J Med Chem. 2010 Jun 24;53(12):4731-48.Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 534971 | The nicotinic acetylcholine receptor agonist ABT-594 increases FGF-2 expression in various rat brain regions. Neuroreport. 1999 Dec 16;10(18):3909-13. | ||||
| Ref 537889 | (S)-3-methyl-5-(1-methyl-2-pyrrolidinyl)isoxazole (ABT 418): a novel cholinergic ligand with cognition-enhancing and anxiolytic activities: II. In vivo characterization. J Pharmacol Exp Ther. 1994 Jul;270(1):319-28. | ||||
| Ref 537901 | Mechanism of long-lasting block of ganglion nicotinic receptors by mono-ammonium compounds with long aliphatic chain. J Auton Nerv Syst. 1994 Aug;48(3):231-40. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

