Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T74952
|
||||
| Former ID |
TTDR00978
|
||||
| Target Name |
CAMP-dependent protein kinase type II-beta regulatory chain
|
||||
| Gene Name |
PRKAR2B
|
||||
| Synonyms |
PKA RIIbeta-subunit; RIIbeta subunit of cAMP-dependent protein kinase; Type RIIbeta regulatory subunit of protein kinase A; PRKAR2B
|
||||
| Target Type |
Discontinued
|
||||
| Function |
Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T74952
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.1.37
|
||||
| Sequence |
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA |
||||
| Drugs and Mode of Action | |||||
| Inhibitor | 4-[(3,5-diamino-1H-pyrazol-4-yl)diazenyl]phenol | Drug Info | [528490] | ||
| AdcAhxArg4Lys(biotin)-PEG-OMe | Drug Info | [526704] | |||
| AdcAhxArg4Lys-PEGOMe | Drug Info | [526704] | |||
| AdcAhxArg4NH(CH2)6NH2 | Drug Info | [526704] | |||
| AdcAhxArg6 | Drug Info | [526704] | |||
| AdoC(Ahx)Arg6 | Drug Info | [525511] | |||
| AdoC(Aoc)Arg6 | Drug Info | [525511] | |||
| AdoC(Aun)Arg6 | Drug Info | [525511] | |||
| AdoC(beta-Ala)2AlaArg6 | Drug Info | [525511] | |||
| AdoC(beta-Ala)Arg6 | Drug Info | [525511] | |||
| AdoC(betaAsp)2AlaArg6 | Drug Info | [525511] | |||
| AdoC(Dpr)2AlaArg6 | Drug Info | [525511] | |||
| AdoC(GABA)Arg6 | Drug Info | [525511] | |||
| AdoCGlyArg6 | Drug Info | [525511] | |||
| BALANOL | Drug Info | [527710] | |||
| Cyclic Adenosine Monophosphate | Drug Info | [551393] | |||
| Ro-4396686 | Drug Info | [528018] | |||
| Pathways | |||||
| KEGG Pathway | Apoptosis | ||||
| Insulin signaling pathway | |||||
| PANTHER Pathway | Endothelin signaling pathway | ||||
| Hedgehog signaling pathway | |||||
| Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
| Metabotropic glutamate receptor group III pathway | |||||
| Metabotropic glutamate receptor group II pathway | |||||
| Muscarinic acetylcholine receptor 2 and 4 signaling pathway | |||||
| Transcription regulation by bZIP transcription factor | |||||
| 5HT1 type receptor mediated signaling pathway | |||||
| Beta1 adrenergic receptor signaling pathway | |||||
| Beta2 adrenergic receptor signaling pathway | |||||
| Histamine H2 receptor mediated signaling pathway | |||||
| GABA-B receptor II signaling | |||||
| Dopamine receptor mediated signaling pathway | |||||
| Enkephalin release | |||||
| Reactome | PKA activation | ||||
| PKA activation in glucagon signalling | |||||
| DARPP-32 events | |||||
| Regulation of PLK1 Activity at G2/M Transition | |||||
| Loss of Nlp from mitotic centrosomes | |||||
| Recruitment of mitotic centrosome proteins and complexes | |||||
| Loss of proteins required for interphase microtubule organization?from the centrosome | |||||
| Glucagon-like Peptide-1 (GLP1) regulates insulin secretion | |||||
| Vasopressin regulates renal water homeostasis via Aquaporins | |||||
| Hedgehog ' | |||||
| off' | |||||
| state | |||||
| Anchoring of the basal body to the plasma membrane | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Calcium Regulation in the Cardiac Cell | |||||
| G Protein Signaling Pathways | |||||
| Myometrial Relaxation and Contraction Pathways | |||||
| DAG and IP3 signaling | |||||
| Regulation of Water Balance by Renal Aquaporins | |||||
| miRs in Muscle Cell Differentiation | |||||
| Opioid Signalling | |||||
| Mitotic G2-G2/M phases | |||||
| Integration of energy metabolism | |||||
| Factors involved in megakaryocyte development and platelet production | |||||
| References | |||||
| Ref 525511 | Bioorg Med Chem Lett. 1999 May 17;9(10):1447-52.Adenosine-5'-carboxylic acid peptidyl derivatives as inhibitors of protein kinases. | ||||
| Ref 526704 | Bioorg Med Chem Lett. 2003 Sep 15;13(18):3035-9.Liquid-phase synthesis of a pegylated adenosine-oligoarginine conjugate, cell-permeable inhibitor of cAMP-dependent protein kinase. | ||||
| Ref 527710 | J Med Chem. 2005 Sep 8;48(18):5613-38.Joys of molecules. 2. Endeavors in chemical biology and medicinal chemistry. | ||||
| Ref 528018 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3. Epub 2006 Feb 3.Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

