Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T82543
|
||||
| Former ID |
TTDC00301
|
||||
| Target Name |
Neuronal acetylcholine receptor protein, beta-2 chain
|
||||
| Gene Name |
CHRNB2
|
||||
| Synonyms |
Beta-2 nAChR; Nicotinic acetylcholine receptor beta 2-subunit protein; Nicotinic acetylcholine receptor beta2; Alpha-4/beta-2 nicotinic receptor; CHRNB2
|
||||
| Target Type |
Discontinued
|
||||
| Disease | Alzheimer disease [ICD9: 331; ICD10: G30] | ||||
| Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane permeable to sodiun ions.
|
||||
| BioChemical Class |
Neurotransmitter receptor
|
||||
| Target Validation |
T82543
|
||||
| UniProt ID | |||||
| Sequence |
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ PLFQNYTTTTFLHSDHSAPSSK |
||||
| Structure |
2GVT; 2LLY; 2GVT; 2K58; 2K59; 2KSR; 2LM2
|
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | ||
| (2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol | Drug Info | [530946] | |||
| 3-[2-(N,N,N-trimethylammonium)ethoxy]pyridine | Drug Info | [528245] | |||
| 4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one | Drug Info | [531079] | |||
| 6'-methylepibatidine | Drug Info | [529145] | |||
| BOLDINE | Drug Info | [528761] | |||
| CMI-489 | Drug Info | [529145] | |||
| CYTISINE | Drug Info | [528394] | |||
| GCCSHPACAGNNQHIC* | Drug Info | [527644] | |||
| GCCSNPVCHLEHSNLC* | Drug Info | [527644] | |||
| HOMOEPIBATIDINE | Drug Info | [528394] | |||
| N,N-dimethyl(pyridin-3-yl)methanamine | Drug Info | [527965] | |||
| N,N-dimethyl-2-(pyridin-3-yloxy)ethanamine | Drug Info | [527965] | |||
| N,N-dimethyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-ethyl-N-methyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-methyl-2-(pyridin-3-yloxy)ethanamine | Drug Info | [527965] | |||
| N-methyl-4-(pyridin-3-yl)but-3-yn-1-amine | Drug Info | [527965] | |||
| N-methyl-N-(pyridin-3-ylmethyl)ethanamine | Drug Info | [527965] | |||
| Predicentrine methiodide | Drug Info | [528761] | |||
| Blocker (channel blocker) | A-867744 | Drug Info | [530093] | ||
| NS1738 | Drug Info | [528946] | |||
| Agonist | ABT-418 | Drug Info | [535007], [537889] | ||
| ABT-594 | Drug Info | [534971] | |||
| TC-2559 | Drug Info | [526677] | |||
| [125I]epibatidine | Drug Info | [543842] | |||
| [3H]cytisine | Drug Info | [543842] | |||
| [3H]epibatidine | Drug Info | [543842] | |||
| [3H]nicotine | Drug Info | [543842] | |||
| Antagonist | Laudanosine | Drug Info | [535185] | ||
| Volatile anesthetics | Drug Info | [535371] | |||
| Modulator (allosteric modulator) | LY2087101 | Drug Info | [528221] | ||
| NS9283 | Drug Info | [531561] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Neuroactive ligand-receptor interaction | ||||
| Cholinergic synapse | |||||
| Nicotine addiction | |||||
| PANTHER Pathway | Nicotinic acetylcholine receptor signaling pathway | ||||
| Nicotine pharmacodynamics pathway | |||||
| Reactome | Highly sodium permeable acetylcholine nicotinic receptors | ||||
| Highly calcium permeable postsynaptic nicotinic acetylcholine receptors | |||||
| Highly calcium permeable nicotinic acetylcholine receptors | |||||
| WikiPathways | SIDS Susceptibility Pathways | ||||
| Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell | |||||
| Nicotine Activity on Dopaminergic Neurons | |||||
| References | |||||
| Ref 540604 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3989). | ||||
| Ref 545652 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004036) | ||||
| Ref 526677 | The nicotinic alpha 4 beta 2 receptor selective agonist, TC-2559, increases dopamine neuronal activity in the ventral tegmental area of rat midbrain slices. Neuropharmacology. 2003 Sep;45(3):334-44. | ||||
| Ref 527644 | J Med Chem. 2005 Jul 28;48(15):4705-45.Neuronal nicotinic acetylcholine receptors: structural revelations, target identifications, and therapeutic inspirations. | ||||
| Ref 527965 | Bioorg Med Chem Lett. 2006 Apr 1;16(7):2013-6. Epub 2006 Jan 18.Synthesis and analgesic activity of secondary amine analogues of pyridylmethylamine and positional isomeric analogues of ABT-594. | ||||
| Ref 528221 | Identification and pharmacological profile of a new class of selective nicotinic acetylcholine receptor potentiators. J Pharmacol Exp Ther. 2006 Sep;318(3):1108-17. Epub 2006 May 31. | ||||
| Ref 528245 | Bioorg Med Chem Lett. 2006 Aug 15;16(16):4283-6. Epub 2006 Jun 9.Aryloxyethylamines: binding at alpha7 nicotinic acetylcholine receptors. | ||||
| Ref 528394 | Bioorg Med Chem Lett. 2006 Nov 1;16(21):5493-7. Epub 2006 Aug 28.Epibatidine isomers and analogues: structure-activity relationships. | ||||
| Ref 528761 | Bioorg Med Chem. 2007 May 15;15(10):3368-72. Epub 2007 Mar 13.Aporphine metho salts as neuronal nicotinic acetylcholine receptor blockers. | ||||
| Ref 528946 | An allosteric modulator of the alpha7 nicotinic acetylcholine receptor possessing cognition-enhancing properties in vivo. J Pharmacol Exp Ther. 2007 Oct;323(1):294-307. Epub 2007 Jul 11. | ||||
| Ref 529145 | J Med Chem. 2007 Dec 13;50(25):6383-91. Epub 2007 Nov 10.Synthesis and nicotinic acetylcholine receptor binding properties of bridged and fused ring analogues of epibatidine. | ||||
| Ref 530093 | J Pharmacol Exp Ther. 2009 Jul;330(1):257-67. Epub 2009 Apr 23.In vitro pharmacological characterization of a novel allosteric modulator of alpha 7 neuronal acetylcholine receptor, 4-(5-(4-chlorophenyl)-2-methyl-3-propionyl-1H-pyrrol-1-yl)benzenesulfonamide (A-867744), exhibiting unique pharmacological profile. | ||||
| Ref 530946 | J Med Chem. 2010 Jun 24;53(12):4731-48.Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. | ||||
| Ref 531079 | J Med Chem. 2010 Sep 9;53(17):6386-97.Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 receptor agonist with unprecedented selectivity and procognitive potential. | ||||
| Ref 531561 | alpha4beta2 neuronal nicotinic receptor positive allosteric modulation: an approach for improving the therapeutic index of alpha4beta2 nAChR agonists in pain. Biochem Pharmacol. 2011 Oct 15;82(8):959-66. | ||||
| Ref 534971 | The nicotinic acetylcholine receptor agonist ABT-594 increases FGF-2 expression in various rat brain regions. Neuroreport. 1999 Dec 16;10(18):3909-13. | ||||
| Ref 535007 | Nicotine, brain nicotinic receptors, and neuropsychiatric disorders. Arch Med Res. 2000 Mar-Apr;31(2):131-44. | ||||
| Ref 535185 | Blockade and activation of the human neuronal nicotinic acetylcholine receptors by atracurium and laudanosine. Anesthesiology. 2001 Apr;94(4):643-51. | ||||
| Ref 535371 | The role of nicotinic acetylcholine receptors in the mechanisms of anesthesia. Brain Res Bull. 2002 Jan 15;57(2):133-50. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

