Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T40276
|
||||
| Former ID |
TTDC00163
|
||||
| Target Name |
Protein kinase C, beta type
|
||||
| Gene Name |
PRKCB
|
||||
| Synonyms |
PKC-B; PKC-beta; Protein Kinase C beta; PRKCB
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Brain cancer; Central nervous system tumors [ICD9: 191; ICD10: C71] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Glioblastoma multiforme [ICD9: 191; ICD10: C71] | |||||
| Human immunodeficiency virus infection [ICD9: 279.3; ICD10: B20-B26] | |||||
| Lymphoma [ICD9: 202.8, 208.9; ICD10: C81-C86] | |||||
| Non-hodgkin's lymphoma [ICD10: C85] | |||||
| Renal transplantation [ICD9: 279.5; ICD10: D89.8] | |||||
| Function |
This is a calcium-activated, phospholipid-dependent, serine- and threonine-specific enzyme. Pkc is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. Pkc also serves as the receptor for phorbol esters.
|
||||
| BioChemical Class |
Kinase
|
||||
| Target Validation |
T40276
|
||||
| UniProt ID | |||||
| EC Number |
EC 2.7.11.13
|
||||
| Sequence |
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF SYTNPEFVINV |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Enzastaurin | Drug Info | Phase 3 | Non-hodgkin's lymphoma | [529450], [537114], [541035] |
| RUBOXISTAURIN HYDROCHLORIDE | Drug Info | Phase 3 | Lymphoma | [528812] | |
| Enzastaurin | Drug Info | Phase 2 | Glioblastoma multiforme | [537114], [541035] | |
| LY333531 | Drug Info | Phase 2 | Cancer | [522041] | |
| Sotrastaurin acetate | Drug Info | Phase 2 | Renal transplantation | [537117] | |
| Enzastaurin | Drug Info | Phase 1 | Brain cancer; Central nervous system tumors | [537114], [541035] | |
| BALANOL | Drug Info | Terminated | Discovery agent | [542983], [545589] | |
| LY-317644 | Drug Info | Terminated | Discovery agent | [546513] | |
| RO-320432 | Drug Info | Terminated | Discovery agent | [541291], [545975] | |
| Inhibitor | (-)-Cercosporamide | Drug Info | [529887] | ||
| 2,3,3-Triphenyl-acrylonitrile | Drug Info | [528755] | |||
| 2-(4-Hydroxy-phenyl)-3,3-diphenyl-acrylonitrile | Drug Info | [528755] | |||
| 3,3-Bis-(4-hydroxy-phenyl)-2-phenyl-acrylonitrile | Drug Info | [528755] | |||
| 3,3-Bis-(4-methoxy-phenyl)-2-phenyl-acrylonitrile | Drug Info | [528755] | |||
| 3-(1H-Indol-3-yl)-4-phenylamino-pyrrole-2,5-dione | Drug Info | [527221] | |||
| 3-(4-Hydroxy-phenyl)-2,3-diphenyl-acrylonitrile | Drug Info | [528755] | |||
| 4-cycloheptyliden(4-hydroxyphenyl)methylphenol | Drug Info | [528755] | |||
| 4-cyclohexyliden(4-hydroxyphenyl)methylphenol | Drug Info | [528755] | |||
| 4-cyclopentyliden(4-hydroxyphenyl)methylphenol | Drug Info | [528755] | |||
| 4-[1-(4-hydroxyphenyl)-3-methyl-1-butenyl]phenol | Drug Info | [528755] | |||
| BALANOL | Drug Info | [551285] | |||
| Go 6983 | Drug Info | [534191] | |||
| Indolocarbazole analogue | Drug Info | [526234] | |||
| K00248 | Drug Info | [527221] | |||
| LY-317644 | Drug Info | [551283] | |||
| LY-326449 | Drug Info | [534154] | |||
| LY333531 | Drug Info | [535082], [535683], [538038] | |||
| Molecule 26 | Drug Info | [535441] | |||
| O-Phosphoethanolamine | Drug Info | [551393] | |||
| PROSTRATIN | Drug Info | [527606] | |||
| PUNICAFOLIN | Drug Info | [551233] | |||
| RO-316233 | Drug Info | [528701] | |||
| Ro-32-0557 | Drug Info | [551264] | |||
| RO-320432 | Drug Info | [551264] | |||
| Sotrastaurin acetate | Drug Info | [537117] | |||
| TANNIN | Drug Info | [551233] | |||
| [2,2':5',2'']Terthiophen-4-yl-methanol | Drug Info | [525575] | |||
| [2,2':5',2'']Terthiophene-4,5''-dicarbaldehyde | Drug Info | [525575] | |||
| [2,2':5',2'']Terthiophene-4-carbaldehyde | Drug Info | [525575] | |||
| Modulator | Enzastaurin | Drug Info | [529450] | ||
| RUBOXISTAURIN HYDROCHLORIDE | Drug Info | [528812] | |||
| Pathways | |||||
| KEGG Pathway | MAPK signaling pathway | ||||
| ErbB signaling pathway | |||||
| Ras signaling pathway | |||||
| Rap1 signaling pathway | |||||
| Calcium signaling pathway | |||||
| Chemokine signaling pathway | |||||
| NF-kappa B signaling pathway | |||||
| HIF-1 signaling pathway | |||||
| Phosphatidylinositol signaling system | |||||
| Sphingolipid signaling pathway | |||||
| mTOR signaling pathway | |||||
| Vascular smooth muscle contraction | |||||
| Wnt signaling pathway | |||||
| VEGF signaling pathway | |||||
| Focal adhesion | |||||
| Tight junction | |||||
| Gap junction | |||||
| Natural killer cell mediated cytotoxicity | |||||
| B cell receptor signaling pathway | |||||
| Fc epsilon RI signaling pathway | |||||
| Fc gamma R-mediated phagocytosis | |||||
| Leukocyte transendothelial migration | |||||
| Circadian entrainment | |||||
| Long-term potentiation | |||||
| Retrograde endocannabinoid signaling | |||||
| Glutamatergic synapse | |||||
| Cholinergic synapse | |||||
| Serotonergic synapse | |||||
| GABAergic synapse | |||||
| Dopaminergic synapse | |||||
| Long-term depression | |||||
| Inflammatory mediator regulation of TRP channels | |||||
| Insulin secretion | |||||
| GnRH signaling pathway | |||||
| Melanogenesis | |||||
| Thyroid hormone synthesis | |||||
| Thyroid hormone signaling pathway | |||||
| Oxytocin signaling pathway | |||||
| Aldosterone-regulated sodium reabsorption | |||||
| Endocrine and other factor-regulated calcium reabsorption | |||||
| Salivary secretion | |||||
| Gastric acid secretion | |||||
| Pancreatic secretion | |||||
| Carbohydrate digestion and absorption | |||||
| Amphetamine addiction | |||||
| Morphine addiction | |||||
| Vibrio cholerae infection | |||||
| Leishmaniasis | |||||
| African trypanosomiasis | |||||
| Amoebiasis | |||||
| Hepatitis B | |||||
| Influenza A | |||||
| Pathways in cancer | |||||
| Proteoglycans in cancer | |||||
| MicroRNAs in cancer | |||||
| Glioma | |||||
| Non-small cell lung cancer | |||||
| Choline metabolism in cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| PANTHER Pathway | Alzheimer disease-amyloid secretase pathway | ||||
| Angiogenesis | |||||
| Apoptosis signaling pathway | |||||
| B cell activation | |||||
| EGF receptor signaling pathway | |||||
| Endothelin signaling pathway | |||||
| FGF signaling pathway | |||||
| Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway | |||||
| Inflammation mediated by chemokine and cytokine signaling pathway | |||||
| Metabotropic glutamate receptor group I pathway | |||||
| Muscarinic acetylcholine receptor 1 and 3 signaling pathway | |||||
| VEGF signaling pathway | |||||
| Wnt signaling pathway | |||||
| 5HT2 type receptor mediated signaling pathway | |||||
| Histamine H1 receptor mediated signaling pathway | |||||
| Oxytocin receptor mediated signaling pathway | |||||
| Thyrotropin-releasing hormone receptor signaling pathway | |||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Fc-epsilon receptor I signaling in mast cells | ||||
| TCR signaling in na& | |||||
| #xef | |||||
| ve CD4+ T cells | |||||
| TCR signaling in na& | |||||
| ve CD8+ T cells | |||||
| IL2-mediated signaling events | |||||
| Ras signaling in the CD4+ TCR pathway | |||||
| JNK signaling in the CD4+ TCR pathway | |||||
| Regulation of Ras family activation | |||||
| Downstream signaling in na& | |||||
| Reactome | Disinhibition of SNARE formation | ||||
| Activation of NF-kappaB in B cells | |||||
| Trafficking of GluR2-containing AMPA receptors | |||||
| G alpha (z) signalling events | |||||
| Depolymerisation of the Nuclear Lamina | |||||
| WNT5A-dependent internalization of FZD4 | |||||
| VEGFR2 mediated cell proliferation | |||||
| Response to elevated platelet cytosolic Ca2+ | |||||
| WikiPathways | Calcium Regulation in the Cardiac Cell | ||||
| Insulin Signaling | |||||
| EGF/EGFR Signaling Pathway | |||||
| Wnt Signaling Pathway | |||||
| Wnt Signaling Pathway and Pluripotency | |||||
| MAPK Signaling Pathway | |||||
| Wnt Signaling Pathway Netpath | |||||
| G Protein Signaling Pathways | |||||
| Kit receptor signaling pathway | |||||
| Myometrial Relaxation and Contraction Pathways | |||||
| Signaling by the B Cell Receptor (BCR) | |||||
| Oncostatin M Signaling Pathway | |||||
| Corticotropin-releasing hormone | |||||
| AGE/RAGE pathway | |||||
| B Cell Receptor Signaling Pathway | |||||
| Signaling Pathways in Glioblastoma | |||||
| miRs in Muscle Cell Differentiation | |||||
| Response to elevated platelet cytosolic Ca2+ | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| Physiological and Pathological Hypertrophy of the Heart | |||||
| References | |||||
| Ref 522041 | ClinicalTrials.gov (NCT00482976) Effect of LY333531 on Vascular and Neural Functions. U.S. National Institutes of Health. | ||||
| Ref 529450 | The oral protein-kinase C beta inhibitor enzastaurin (LY317615) suppresses signalling through the AKT pathway, inhibits proliferation and induces apoptosis in multiple myeloma cell lines. Leuk Lymphoma. 2008 Jul;49(7):1374-83. | ||||
| Ref 541035 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5693). | ||||
| Ref 541291 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6034). | ||||
| Ref 542983 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8142). | ||||
| Ref 545589 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003814) | ||||
| Ref 525575 | Bioorg Med Chem Lett. 1999 Aug 2;9(15):2279-82.Novel protein kinase C inhibitors: synthesis and PKC inhibition of beta-substituted polythiophene derivatives. | ||||
| Ref 526234 | Bioorg Med Chem Lett. 2002 Jan 21;12(2):147-50.Mixed lineage kinase activity of indolocarbazole analogues. | ||||
| Ref 527221 | Bioorg Med Chem Lett. 2004 Oct 18;14(20):5171-4.Synthesis of anilino-monoindolylmaleimides as potent and selective PKCbeta inhibitors. | ||||
| Ref 527606 | J Med Chem. 1992 May 29;35(11):1978-86.A nonpromoting phorbol from the samoan medicinal plant Homalanthus nutans inhibits cell killing by HIV-1. | ||||
| Ref 528701 | J Med Chem. 1992 Jan;35(1):177-84.Inhibitors of protein kinase C. 1. 2,3-Bisarylmaleimides. | ||||
| Ref 528755 | J Med Chem. 1992 Feb 7;35(3):573-83.Multivariate analysis by the minimum spanning tree method of the structural determinants of diphenylethylenes and triphenylacrylonitriles implicated in estrogen receptor binding, protein kinase C activity, and MCF7 cell proliferation. | ||||
| Ref 529450 | The oral protein-kinase C beta inhibitor enzastaurin (LY317615) suppresses signalling through the AKT pathway, inhibits proliferation and induces apoptosis in multiple myeloma cell lines. Leuk Lymphoma. 2008 Jul;49(7):1374-83. | ||||
| Ref 529887 | Bioorg Med Chem Lett. 2009 Feb 1;19(3):724-6. Epub 2008 Dec 11.(-)-Cercosporamide derivatives as novel antihyperglycemic agents. | ||||
| Ref 534154 | J Med Chem. 1996 Jul 5;39(14):2664-71.(S)-13-[(dimethylamino)methyl]-10,11,14,15-tetrahydro-4,9:16, 21-dimetheno-1H, 13H-dibenzo[e,k]pyrrolo[3,4-h][1,4,13]oxadiazacyclohexadecene-1,3(2H)-d ione (LY333531) and related analogues: isozyme selective inhibitors of protein kinase C beta. | ||||
| Ref 534191 | Inhibition of protein kinase C mu by various inhibitors. Differentiation from protein kinase c isoenzymes. FEBS Lett. 1996 Aug 26;392(2):77-80. | ||||
| Ref 535082 | Protein kinase C activation and its pharmacological inhibition in vascular disease. Vasc Med. 2000;5(3):173-85. | ||||
| Ref 535441 | Potential new medical therapies for diabetic retinopathy: protein kinase C inhibitors. Am J Ophthalmol. 2002 May;133(5):693-8. | ||||
| Ref 535683 | Protein kinase C beta inhibition attenuates the progression of experimental diabetic nephropathy in the presence of continued hypertension. Diabetes. 2003 Feb;52(2):512-8. | ||||
| Ref 538038 | Characterization of protein kinase C beta isoform activation on the gene expression of transforming growth factor-beta, extracellular matrix components, and prostanoids in the glomeruli of diabetic rats. J Clin Invest. 1997 Jul 1;100(1):115-26. | ||||
| Ref 551233 | Tannins as selective inhibitors of protein kinase C, Bioorg. Med. Chem. Lett. 2(3):239-244 (1992). | ||||
| Ref 551264 | Bisindolylmaleimide inhibitors of protein kinase C. Further conformational restriction of a tertiary amine side chain, Bioorg. Med. Chem. Lett. 4(11):1303-1308 (1994). | ||||
| Ref 551283 | Synthesis of bisindolylmaleimide macrocycles, Bioorg. Med. Chem. Lett. 5(18):2093-2096 (1995). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

