Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T63816
|
||||
| Former ID |
TTDC00159
|
||||
| Target Name |
Histone deacetylase 4
|
||||
| Gene Name |
HDAC4
|
||||
| Synonyms |
HD4; Histone deacetylase 4; HDAC4
|
||||
| Target Type |
Research
|
||||
| Disease | Advanced stage follicular lymphoma [ICD9: 202; ICD10: C82] | ||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Huntington's disease [ICD9: 294.1, 333.4; ICD10: F02.2, G10] | |||||
| Function |
Responsible forthe deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.
|
||||
| BioChemical Class |
Carbon-nitrogen hydrolase
|
||||
| Target Validation |
T63816
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.5.1.98
|
||||
| Sequence |
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE EPPL |
||||
| Structure |
2H8N; 2O94; 2VQJ; 2VQM; 2VQO; 2VQQ; 2VQV; 2VQW; 3UXG;3UZD; 3V31; 4CBT; 4CBY; 2H8N; 2O94; 2VQJ; 2VQM; 2VQO; 2VQQ; 2VQV; 2VQW; 3UXG; 3UZD; 3V31; 4CBT; 4CBY
|
||||
| Drugs and Mode of Action | |||||
| Inhibitor | (E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one | Drug Info | [526871] | ||
| 2,2-bis(3-fluorophenyl)-N-hydroxyacetamide | Drug Info | [530327] | |||
| 2,2-bis(4-chlorophenyl)-N-hydroxyacetamide | Drug Info | [530327] | |||
| 2,2-bis(4-fluorophenyl)-N-hydroxyacetamide | Drug Info | [530327] | |||
| 2-(methylsulfonylthio)ethyl 2-propylpentanoate | Drug Info | [529333] | |||
| 4-Benzoylamino-N-hydroxy-benzamide | Drug Info | [527691] | |||
| 4-Butyrylamino-N-hydroxy-benzamide | Drug Info | [526922] | |||
| 4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526878] | |||
| 4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| 4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide | Drug Info | [526266] | |||
| 5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide | Drug Info | [527056] | |||
| 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione | Drug Info | [529333] | |||
| 5-Mercapto-pentanoic acid phenylamide | Drug Info | [527439] | |||
| 6-(2-Bromo-acetylamino)-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-benzenesulfinylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-benzenesulfonylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 6-Mercapto-hexanoic acid phenylamide | Drug Info | [527439] | |||
| 6-Phenoxy-hexane-1-thiol | Drug Info | [527439] | |||
| 6-phenylsulfanylhexanoic acid hydroxamide | Drug Info | [527980] | |||
| 7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one | Drug Info | [526878] | |||
| 7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one | Drug Info | [526871] | |||
| 7-Mercapto-heptanoic acid benzothiazol-2-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid biphenyl-4-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid phenylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid pyridin-3-ylamide | Drug Info | [527439] | |||
| 7-Mercapto-heptanoic acid quinolin-3-ylamide | Drug Info | [527439] | |||
| 7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide | Drug Info | [529093] | |||
| 8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one | Drug Info | [526871] | |||
| 8-Mercapto-octanoic acid phenylamide | Drug Info | [527439] | |||
| 8-Oxo-8-phenyl-octanoic acid | Drug Info | [526266] | |||
| 8-Oxo-8-phenyl-octanoic acid hydroxyamide | Drug Info | [526878] | |||
| 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide | Drug Info | [526878] | |||
| 9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one | Drug Info | [526878] | |||
| AZUMAMIDE B | Drug Info | [529411] | |||
| AZUMAMIDE C | Drug Info | [529411] | |||
| AZUMAMIDE E | Drug Info | [529411] | |||
| Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-) | Drug Info | [529054] | |||
| Cyclostellettamine derivative | Drug Info | [527058] | |||
| LARGAZOLE | Drug Info | [530933] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide | Drug Info | [527500] | |||
| N-(2-Mercapto-ethyl)-N'-phenyl-succinamide | Drug Info | [527500] | |||
| N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide | Drug Info | [526878] | |||
| N-(6-Hydroxycarbamoyl-hexyl)-benzamide | Drug Info | [526266] | |||
| N-(6-Mercapto-hexyl)-benzamide | Drug Info | [527439] | |||
| N-hydroxy-2,2-diphenylacetamide | Drug Info | [530327] | |||
| N-hydroxy-2,2-diphenylpropanamide | Drug Info | [530327] | |||
| N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide | Drug Info | [527691] | |||
| N-Hydroxy-4-(pentanoylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide | Drug Info | [526922] | |||
| N-Hydroxy-4-phenylacetylamino-benzamide | Drug Info | [527691] | |||
| N-hydroxy-9,10-dihydroanthracene-9-carboxamide | Drug Info | [530327] | |||
| N-hydroxy-9H-xanthene-9-carboxamide | Drug Info | [530327] | |||
| Octanedioic acid bis-hydroxyamide | Drug Info | [526376] | |||
| Octanedioic acid hydroxyamide pyridin-2-ylamide | Drug Info | [526266] | |||
| Octanedioic acid hydroxyamide pyridin-4-ylamide | Drug Info | [526266] | |||
| PSAMMAPLIN A | Drug Info | [526878] | |||
| Quisinostat | Drug Info | [1725887] | |||
| santacruzamate A | Drug Info | [532523] | |||
| ST-2987 | Drug Info | [530016] | |||
| ST-3050 | Drug Info | [530016] | |||
| Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester | Drug Info | [527439] | |||
| TMP269 | Drug Info | [532282] | |||
| Modulator | HDAC4 inhibtors | Drug Info | [543681] | ||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| KEGG Pathway | Alcoholism | ||||
| Epstein-Barr virus infection | |||||
| Viral carcinogenesis | |||||
| MicroRNAs in cancer | |||||
| NetPath Pathway | IL2 Signaling Pathway | ||||
| Pathway Interaction Database | Signaling events mediated by HDAC Class II | ||||
| Signaling events mediated by HDAC Class III | |||||
| Signaling events mediated by HDAC Class I | |||||
| Sumoylation by RanBP2 regulates transcriptional repression | |||||
| Validated nuclear estrogen receptor alpha network | |||||
| Reactome | NOTCH1 Intracellular Domain Regulates Transcription | ||||
| Constitutive Signaling by NOTCH1 PEST Domain Mutants | |||||
| Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants | |||||
| WikiPathways | Endochondral Ossification | ||||
| Cardiac Hypertrophic Response | |||||
| Neural Crest Differentiation | |||||
| miR-targeted genes in muscle cell - TarBase | |||||
| miR-targeted genes in lymphocytes - TarBase | |||||
| miR-targeted genes in epithelium - TarBase | |||||
| TarBasePathway | |||||
| Cell Cycle | |||||
| MicroRNAs in cardiomyocyte hypertrophy | |||||
| References | |||||
| Ref 526266 | J Med Chem. 2002 Feb 14;45(4):753-7.Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. | ||||
| Ref 526376 | J Med Chem. 2002 Jul 18;45(15):3296-309.Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differentiation, and inhibition of proliferation in Friend leukemic cells. | ||||
| Ref 526871 | Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.Heterocyclic ketones as inhibitors of histone deacetylase. | ||||
| Ref 526922 | J Med Chem. 2004 Jan 15;47(2):467-74.Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. | ||||
| Ref 527056 | Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. | ||||
| Ref 527058 | Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. | ||||
| Ref 527439 | J Med Chem. 2005 Feb 24;48(4):1019-32.Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxamates. | ||||
| Ref 527500 | Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. | ||||
| Ref 527691 | J Med Chem. 2005 Aug 25;48(17):5530-5.Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. | ||||
| Ref 527980 | J Med Chem. 2006 Jan 26;49(2):800-5.Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. | ||||
| Ref 529054 | Bioorg Med Chem. 2007 Dec 15;15(24):7830-9. Epub 2007 Aug 26.Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. | ||||
| Ref 529093 | J Med Chem. 2007 Nov 1;50(22):5425-38. Epub 2007 Oct 11.Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhibitors. | ||||
| Ref 529333 | Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7. Epub 2008 Feb 8.New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. | ||||
| Ref 529411 | Bioorg Med Chem Lett. 2008 May 1;18(9):2982-4. Epub 2008 Mar 21.Evaluation of antiangiogenic activity of azumamides by the in vitro vascular organization model using mouse induced pluripotent stem (iPS) cells. | ||||
| Ref 530016 | Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9. Epub 2009 Feb 12.N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC)inhibitors. | ||||
| Ref 530327 | Bioorg Med Chem Lett. 2009 Oct 1;19(19):5684-8. Epub 2009 Aug 7.Diphenylmethylene hydroxamic acids as selective class IIa histone deacetylase inhibitors. | ||||
| Ref 530933 | J Med Chem. 2010 Jun 24;53(12):4654-67.Synthesis and biological characterization of the histone deacetylase inhibitor largazole and C7- modified analogues. | ||||
| Ref 532282 | Selective class IIa histone deacetylase inhibition via a nonchelating zinc-binding group. Nat Chem Biol. 2013 May;9(5):319-25. | ||||
| Ref 532523 | Santacruzamate A, a potent and selective histone deacetylase inhibitor from the Panamanian marine cyanobacterium cf. Symploca sp. J Nat Prod. 2013 Nov 22;76(11):2026-33. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

