Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T71192
|
||||
Former ID |
TTDS00183
|
||||
Target Name |
Cysteinyl leukotriene receptor 1
|
||||
Gene Name |
CYSLTR1
|
||||
Synonyms |
CysLTR1; Cysteinyl leukotriene D4 receptor; HG55; HMTMF81; LTD4 receptor; Leukotriene D4-receptor; CYSLTR1
|
||||
Target Type |
Successful
|
||||
Disease | Allergic rhinitis [ICD9: 472.0, 477, 995.3; ICD10: J00, J30, J31.0, T78.4] | ||||
Asthma [ICD10: J45] | |||||
Asthma; Prophylaxis [ICD9: 493; ICD10: J45] | |||||
Allergy [ICD9: 995.3; ICD10: T78.4] | |||||
Migraine [ICD9: 346; ICD10: G43] | |||||
Unspecified [ICD code not available] | |||||
Function |
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >>LTE4 = LTC4 >> LTB4.
|
||||
BioChemical Class |
GPCR rhodopsin
|
||||
Target Validation |
T71192
|
||||
UniProt ID | |||||
Sequence |
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV |
||||
Drugs and Mode of Action | |||||
Drug(s) | Cinalukast | Drug Info | Approved | Asthma | [538016] |
Montelukast | Drug Info | Approved | Asthma | [536361], [540299] | |
Pranlukast | Drug Info | Approved | Asthma; Prophylaxis | [536361], [540487] | |
Zafirlukast | Drug Info | Approved | Asthma | [534965], [540282] | |
Claritin/Singulair | Drug Info | Phase 3 | Allergic rhinitis | [526132], [526996], [551871] | |
BAY-X-7195 | Drug Info | Phase 2 | Asthma | [545585] | |
Iralukast | Drug Info | Phase 2 | Asthma | [529458], [541170] | |
KP-496 | Drug Info | Phase 2 | Asthma | [528550] | |
LM-1507.NA | Drug Info | Phase 2 | Asthma | [546822] | |
Masilukast | Drug Info | Phase 2 | Asthma | [547331] | |
CR-3465 | Drug Info | Phase 1 | Allergy | [547818] | |
YM-57158 | Drug Info | Phase 1 | Allergic rhinitis | [534743] | |
Ablukast | Drug Info | Discontinued in Phase 3 | Asthma | [545175] | |
AS-35 | Drug Info | Discontinued in Phase 2 | Asthma | [544897] | |
DS-4574 | Drug Info | Discontinued in Phase 2 | Asthma | [544688] | |
FK-011 | Drug Info | Discontinued in Phase 2 | Asthma | [546862] | |
L-660771 | Drug Info | Discontinued in Phase 2 | Discovery agent | [541365], [544533] | |
LY-2300559 | Drug Info | Discontinued in Phase 2 | Migraine | [523139] | |
Sulukast | Drug Info | Discontinued in Phase 2 | Asthma | [540287], [544541] | |
RG-7152 | Drug Info | Discontinued in Phase 1 | Asthma | [533831] | |
FPL-55712 | Drug Info | Terminated | Asthma | [544540] | |
L-648051 | Drug Info | Terminated | Asthma | [544545] | |
LM-1376 | Drug Info | Terminated | Asthma | [546076] | |
LY-290154 | Drug Info | Terminated | Asthma | [546276] | |
MCI-826 | Drug Info | Terminated | Asthma | [544954] | |
MDL-43291 | Drug Info | Terminated | Asthma | [544539] | |
OT-4003 | Drug Info | Terminated | Asthma | [534337] | |
Tomelukast | Drug Info | Terminated | Asthma | [544534] | |
Antagonist | 5'-methylthioadenosine | Drug Info | [537937] | ||
BayCysLT2 | Drug Info | [531556] | |||
BAYu9773 | Drug Info | [525921] | |||
Cinalukast | Drug Info | [538016] | |||
LM-1507.NA | Drug Info | [526323], [551871] | |||
MCI-826 | Drug Info | [526754], [551871] | |||
Montelukast | Drug Info | [535660], [537451] | |||
pobilukast | Drug Info | [525572] | |||
Pranlukast | Drug Info | [537612] | |||
RG-7152 | Drug Info | [533831], [551871] | |||
XGP-510 | Drug Info | [543684] | |||
Zafirlukast | Drug Info | [534965], [535660], [535666] | |||
[3H]ICI-198615 | Drug Info | [526751] | |||
Modulator | Ablukast | Drug Info | [1572591] | ||
AS-35 | Drug Info | [526815] | |||
BAY-X-7195 | Drug Info | ||||
CGP-57698 | Drug Info | ||||
Claritin/Singulair | Drug Info | [526132], [526996] | |||
CR-3465 | Drug Info | [1572591] | |||
DS-4574 | Drug Info | [533854] | |||
FK-011 | Drug Info | [526901] | |||
FPL-55712 | Drug Info | [529534] | |||
Iralukast | Drug Info | [534582] | |||
KP-496 | Drug Info | [528550] | |||
L-648051 | Drug Info | ||||
L-660771 | Drug Info | ||||
LM-1376 | Drug Info | [556264] | |||
LY-2300559 | Drug Info | ||||
LY-290154 | Drug Info | ||||
Masilukast | Drug Info | [1572591] | |||
MDL-43291 | Drug Info | ||||
OT-4003 | Drug Info | [534337] | |||
Sulukast | Drug Info | ||||
Tomelukast | Drug Info | ||||
WY-46016 | Drug Info | ||||
YM-57158 | Drug Info | [534743] | |||
Agonist | LTC4 | Drug Info | [525529] | ||
LTD4 | Drug Info | [525572] | |||
LTE4 | Drug Info | [525529] | |||
N-methyl LTC4 | Drug Info | [531263] | |||
[3H]LTD4 | Drug Info | [543684] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
TEP | EXP Info | ||||
Pathways | |||||
KEGG Pathway | Calcium signaling pathway | ||||
Neuroactive ligand-receptor interaction | |||||
NetPath Pathway | TGF_beta_Receptor Signaling Pathway | ||||
IL4 Signaling Pathway | |||||
IL3 Signaling Pathway | |||||
Pathway Interaction Database | Endothelins | ||||
Reactome | Leukotriene receptors | ||||
G alpha (q) signalling events | |||||
WikiPathways | GPCRs, Class A Rhodopsin-like | ||||
Gastrin-CREB signalling pathway via PKC and MAPK | |||||
GPCR ligand binding | |||||
GPCR downstream signaling | |||||
References | |||||
Ref 523139 | ClinicalTrials.gov (NCT01184508) A Study in Migraine Prevention. U.S. National Institutes of Health. | ||||
Ref 526132 | Montelukast, a leukotriene receptor antagonist, for the treatment of persistent asthma in children aged 2 to 5 years. Pediatrics. 2001 Sep;108(3):E48. | ||||
Ref 526996 | A review of montelukast in the treatment of asthma and allergic rhinitis. Expert Opin Pharmacother. 2004 Mar;5(3):679-86. | ||||
Ref 528550 | Effects of KP-496, a novel dual antagonist for leukotriene D4 and thromboxane A2 receptors, on contractions induced by various agonists in the guinea pig trachea. Allergol Int. 2006 Dec;55(4):403-10. | ||||
Ref 533831 | Induction of peroxisomal enzymes by a tetrazole-substituted 2-quinolinylmethoxy leukotriene D4 antagonist. Fundam Appl Toxicol. 1994 Aug;23(2):298-303. | ||||
Ref 534337 | Discovery of OT4003, a novel, potent, and orally active cys-LT1 receptor antagonist. Bioorg Med Chem. 1997 Feb;5(2):415-27. | ||||
Ref 534743 | In vitro pharmacologic profile of YM158, a new dual antagonist for LTD4 and TXA2 receptors. J Pharmacol Exp Ther. 1998 Nov;287(2):633-9. | ||||
Ref 534965 | Role of antileukotriene agents in asthma therapy. J Am Osteopath Assoc. 2000 Jan;100(1):32, 37-43. | ||||
Ref 536361 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20. | ||||
Ref 538016 | Prolonged protection against exercise-induced bronchoconstriction by the leukotriene D4-receptor antagonist cinalukast. J Allergy Clin Immunol. 1997 Feb;99(2):210-5. | ||||
Ref 540282 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3322). | ||||
Ref 540287 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3327). | ||||
Ref 540299 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3340). | ||||
Ref 540487 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3634). | ||||
Ref 541170 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5861). | ||||
Ref 541365 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6193). | ||||
Ref 544533 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000074) | ||||
Ref 544534 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000075) | ||||
Ref 544539 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000087) | ||||
Ref 544540 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000089) | ||||
Ref 544541 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000090) | ||||
Ref 544545 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000103) | ||||
Ref 544688 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000587) | ||||
Ref 544897 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001439) | ||||
Ref 544954 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800001711) | ||||
Ref 545175 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002358) | ||||
Ref 545585 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003794) | ||||
Ref 546076 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006199) | ||||
Ref 546276 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007201) | ||||
Ref 546822 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010469) | ||||
Ref 546862 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010718) | ||||
Ref 547331 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800015230) | ||||
Ref 525529 | Characterization of the human cysteinyl leukotriene CysLT1 receptor. Nature. 1999 Jun 24;399(6738):789-93. | ||||
Ref 525572 | Identification, molecular cloning, expression, and characterization of a cysteinyl leukotriene receptor. Mol Pharmacol. 1999 Sep;56(3):657-63. | ||||
Ref 525921 | Molecular cloning and characterization of a second human cysteinyl leukotriene receptor: discovery of a subtype selective agonist. Mol Pharmacol. 2000 Dec;58(6):1601-8. | ||||
Ref 526132 | Montelukast, a leukotriene receptor antagonist, for the treatment of persistent asthma in children aged 2 to 5 years. Pediatrics. 2001 Sep;108(3):E48. | ||||
Ref 526323 | Pharmacological differences among CysLT(1) receptor antagonists with respect to LTC(4) and LTD(4) in human lung parenchyma. Biochem Pharmacol. 2002 Apr 15;63(8):1537-46. | ||||
Ref 526751 | Heterogeneity of binding sites for ICI 198,615 in human lung parenchyma. Biochem Pharmacol. 1992 Oct 6;44(7):1411-5. | ||||
Ref 526754 | Leukotriene receptors in the skin of rats differ from those of mouse skin or rat stomach strip. Eur J Pharmacol. 1992 Oct 20;221(2-3):333-42. | ||||
Ref 526815 | Peptide leukotriene antagonistic activity of AS-35, a new antiallergic drug. Jpn J Pharmacol. 1992 Apr;58(4):347-55. | ||||
Ref 526901 | Evaluation of human peroxisome proliferator-activated receptor (PPAR) subtype selectivity of a variety of anti-inflammatory drugs based on a novel assay for PPAR delta(beta). J Pharmacol Sci. 2003 Nov;93(3):347-55. | ||||
Ref 526996 | A review of montelukast in the treatment of asthma and allergic rhinitis. Expert Opin Pharmacother. 2004 Mar;5(3):679-86. | ||||
Ref 528550 | Effects of KP-496, a novel dual antagonist for leukotriene D4 and thromboxane A2 receptors, on contractions induced by various agonists in the guinea pig trachea. Allergol Int. 2006 Dec;55(4):403-10. | ||||
Ref 529534 | Effect of the leukotriene receptor antagonists FPL 55712, LY 163443, and MK-571 on the elimination of cysteinyl leukotrienes in the rat. Br J Pharmacol. 1991 Apr;102(4):865-70. | ||||
Ref 531263 | Differential signaling of cysteinyl leukotrienes and a novel cysteinyl leukotriene receptor 2 (CysLT?? agonist, N-methyl-leukotriene C?? in calcium reporter and beta arrestin assays. Mol Pharmacol. 2011 Feb;79(2):270-8. | ||||
Ref 531556 | Synthesis of cysteinyl leukotrienes in human endothelial cells: subcellular localization and autocrine signaling through the CysLT2 receptor. FASEB J. 2011 Oct;25(10):3519-28. | ||||
Ref 533831 | Induction of peroxisomal enzymes by a tetrazole-substituted 2-quinolinylmethoxy leukotriene D4 antagonist. Fundam Appl Toxicol. 1994 Aug;23(2):298-303. | ||||
Ref 533854 | Inhibitory effect of DS-4574, a mast cell stabilizer with peptidoleukotriene receptor antagonism, on gastric acid secretion in rats. Eur J Pharmacol. 1994 Apr 1;255(1-3):229-34. | ||||
Ref 534337 | Discovery of OT4003, a novel, potent, and orally active cys-LT1 receptor antagonist. Bioorg Med Chem. 1997 Feb;5(2):415-27. | ||||
Ref 534582 | Pharmacological characterization of the cysteinyl-leukotriene antagonists CGP 45715A (iralukast) and CGP 57698 in human airways in vitro. Br J Pharmacol. 1998 Feb;123(3):590-8. | ||||
Ref 534743 | In vitro pharmacologic profile of YM158, a new dual antagonist for LTD4 and TXA2 receptors. J Pharmacol Exp Ther. 1998 Nov;287(2):633-9. | ||||
Ref 534965 | Role of antileukotriene agents in asthma therapy. J Am Osteopath Assoc. 2000 Jan;100(1):32, 37-43. | ||||
Ref 535660 | Knockouts model the 100 best-selling drugs--will they model the next 100? Nat Rev Drug Discov. 2003 Jan;2(1):38-51. | ||||
Ref 535666 | Inhibitory effects of zafirlukast on respiratory bursts of human neutrophils. Drugs Exp Clin Res. 2002;28(4):133-45. | ||||
Ref 537451 | Protective Potential of Montelukast Against Hepatic Ischemia/Reperfusion Injury in Rats. J Surg Res. 2008 Sep 7. | ||||
Ref 537612 | Beneficial effects of leukotriene receptor antagonists in the prevention of cedar pollinosis in a community setting. J Investig Allergol Clin Immunol. 2009;19(3):195-203. | ||||
Ref 537937 | Inhibition of the tyrosine kinase activity of the fibroblast growth factor receptor by the methyltransferase inhibitor 5'-methylthioadenosine. J Biol Chem. 1993 Feb 25;268(6):4244-9. | ||||
Ref 538016 | Prolonged protection against exercise-induced bronchoconstriction by the leukotriene D4-receptor antagonist cinalukast. J Allergy Clin Immunol. 1997 Feb;99(2):210-5. | ||||
Ref 543684 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 269). |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.