Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T68290
|
||||
| Former ID |
TTDC00067
|
||||
| Target Name |
Cathepsin S
|
||||
| Gene Name |
CTSS
|
||||
| Synonyms |
Cysteine protease cathepsin S; CTSS
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | Autoimmune diabetes [ICD10: E08-E13] | ||||
| Asthma [ICD10: J45] | |||||
| Cancer [ICD9: 140-229; ICD10: C00-C96] | |||||
| Cardiovascular disorder [ICD10: I00-I99] | |||||
| Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25] | |||||
| Neuropathic pain [ICD9: 356.0, 356.8; ICD10: G64, G90.0] | |||||
| Psoriatic disorder [ICD9: 696; ICD10: L40] | |||||
| Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89] | |||||
| Function |
Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond- specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
|
||||
| BioChemical Class |
Peptidase
|
||||
| Target Validation |
T68290
|
||||
| UniProt ID | |||||
| EC Number |
EC 3.4.22.27
|
||||
| Sequence |
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW GHNFGEEGYIRMARNKGNHCGIASFPSYPEI |
||||
| Drugs and Mode of Action | |||||
| Drug(s) | SAR-114137 | Drug Info | Phase 1 | Pain | [532135] |
| VBY- 036 | Drug Info | Phase 1 | Neuropathic pain | [524350] | |
| VBY- 891 | Drug Info | Phase 1 | Autoimmune diabetes | [524438] | |
| VBY-129 | Drug Info | Phase 1 | Autoimmune diabetes | [551766] | |
| RG-7236 | Drug Info | Discontinued in Phase 1 | Cardiovascular disorder | [549201] | |
| CRA-028129 | Drug Info | Terminated | Psoriatic disorder | [548110] | |
| Inhibitor | 2-[(2',3',4'-TRIFLUOROBIPHENYL-2-YL)OXY]ETHANOL | Drug Info | [551374] | ||
| 4-cycloheptyl-6-propylpyrimidine-2-carbonitrile | Drug Info | [530717] | |||
| 4-cyclooctyl-6-propylpyrimidine-2-carbonitrile | Drug Info | [530717] | |||
| 4-propyl-6-m-tolylpyrimidine-2-carbonitrile | Drug Info | [531005] | |||
| 6-(3-(trifluoromethyl)phenyl)picolinonitrile | Drug Info | [530989] | |||
| Ac-hPhe-Leu-Ala-LeuVSMe | Drug Info | [528196] | |||
| Ac-hPhe-Leu-Gly-LeuVSMe | Drug Info | [528196] | |||
| Ac-hPhe-Leu-Phe-LeuVSMe | Drug Info | [528196] | |||
| AM-3840 | Drug Info | [543601] | |||
| BF/PC-18 | Drug Info | [543601] | |||
| Cbz-Glu(OtBu)-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-hPhe-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-Leu-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-MetO2-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-Phe-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-Pro-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-t-ButylGln-Ala-LeuVSMe | Drug Info | [528196] | |||
| Cbz-Ile-t-ButylhomoGlu-Ala-LeuVSMe | Drug Info | [528196] | |||
| Clik60 | Drug Info | [535523] | |||
| compound (R)-26 | Drug Info | [531940] | |||
| CRA-028129 | Drug Info | [551432] | |||
| E-64 | Drug Info | [535267] | |||
| Fucose | Drug Info | [551393] | |||
| GNF-PF-5434 | Drug Info | [529350] | |||
| JNJ-10329670 | Drug Info | [543601] | |||
| L-006235-1 | Drug Info | [527882] | |||
| L-873724 | Drug Info | [528921] | |||
| N-(1-oxobutan-2-yl)-3-(trifluoromethyl)benzamide | Drug Info | [531241] | |||
| N-(2-naphthylsulfonyl)-glycyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(4-phenylbenzoyl)-phenylalanyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(benzyloxycarbonyl)-leucyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-isoleucyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-leucyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-methionyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-norleucyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-norvalyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-tyrosyl-glycine-nitrile | Drug Info | [527885] | |||
| N-(tert-butoxycarbonyl)-valyl-glycine-nitrile | Drug Info | [527885] | |||
| N-acetyl-phenylalanyl-glycine-nitrile | Drug Info | [527885] | |||
| N-benzoyl-phenylalanyl-glycine-nitrile | Drug Info | [527885] | |||
| P2,P3 Ketoamide derivative | Drug Info | [527197] | |||
| RG-7236 | Drug Info | [543601] | |||
| SAR-114137 | Drug Info | [532135] | |||
| VBY- 036 | Drug Info | [550109] | |||
| VBY- 285 | Drug Info | [543601] | |||
| VBY-129 | Drug Info | [551767] | |||
| Modulator | VBY- 891 | Drug Info | [543601] | ||
| Pathways | |||||
| KEGG Pathway | Lysosome | ||||
| Phagosome | |||||
| Antigen processing and presentation | |||||
| Tuberculosis | |||||
| NetPath Pathway | Leptin Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| Reactome | Endosomal/Vacuolar pathway | ||||
| Degradation of the extracellular matrix | |||||
| Trafficking and processing of endosomal TLR | |||||
| Assembly of collagen fibrils and other multimeric structures | |||||
| MHC class II antigen presentation | |||||
| WikiPathways | Class I MHC mediated antigen processing & | ||||
| presentation | |||||
| Trafficking and processing of endosomal TLR | |||||
| References | |||||
| Ref 524350 | ClinicalTrials.gov (NCT01892891) Safety Study of VBY-036 in Healthy Volunteers After 7 Days of Oral Dosing. U.S. National Institutes of Health. | ||||
| Ref 524438 | ClinicalTrials.gov (NCT01947738) Safety Study of VBY-891 in Healthy Volunteers After Single or Multiple (7 Days) of Oral Dosing (VBY891P1). U.S. National Institutes of Health. | ||||
| Ref 532135 | From laboratory to pilot plant: the solid-state process development of a highly potent cathepsin S/K inhibitor. Eur J Pharm Biopharm. 2013 Apr;83(3):436-48. | ||||
| Ref 548110 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022029) | ||||
| Ref 527197 | Bioorg Med Chem Lett. 2004 Oct 4;14(19):4897-902.Potent and selective P2-P3 ketoamide inhibitors of cathepsin K with good pharmacokinetic properties via favorable P1', P1, and/or P3 substitutions. | ||||
| Ref 527882 | J Med Chem. 2005 Dec 1;48(24):7535-43.Lysosomotropism of basic cathepsin K inhibitors contributes to increased cellular potencies against off-target cathepsins and reduced functional selectivity. | ||||
| Ref 527885 | J Med Chem. 2005 Dec 1;48(24):7688-707.Interaction of papain-like cysteine proteases with dipeptide-derived nitriles. | ||||
| Ref 528196 | J Med Chem. 2006 May 18;49(10):2953-68.Optimization of subsite binding to the beta5 subunit of the human 20S proteasome using vinyl sulfones and 2-keto-1,3,4-oxadiazoles: syntheses and cellular properties of potent, selective proteasome inhibitors. | ||||
| Ref 528921 | Bioorg Med Chem Lett. 2007 Sep 1;17(17):4929-33. Epub 2007 Jun 10.The identification of potent, selective, and bioavailable cathepsin S inhibitors. | ||||
| Ref 529350 | Bioorg Med Chem. 2009 Feb 1;17(3):1064-70. Epub 2008 Feb 7.Substrate optimization for monitoring cathepsin C activity in live cells. | ||||
| Ref 530717 | Bioorg Med Chem Lett. 2010 Mar 1;20(5):1524-7. Epub 2010 Jan 25.Design and optimization of a series of novel 2-cyano-pyrimidines as cathepsin K inhibitors. | ||||
| Ref 530989 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4507-10. Epub 2010 Jun 10.4-(3-Trifluoromethylphenyl)-pyrimidine-2-carbonitrile as cathepsin S inhibitors: N3, not N1 is critically important. | ||||
| Ref 531005 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4447-50. Epub 2010 Jun 15.2-Phenyl-9H-purine-6-carbonitrile derivatives as selective cathepsin S inhibitors. | ||||
| Ref 531241 | Bioorg Med Chem Lett. 2010 Dec 1;20(23):6890-4. Epub 2010 Oct 26.Trifluoromethylphenyl as P2 for ketoamide-based cathepsin S inhibitors. | ||||
| Ref 531940 | Selective nitrile inhibitors to modulate the proteolytic synergism of cathepsins S and F. J Med Chem. 2012 Jun 28;55(12):5982-6. | ||||
| Ref 532135 | From laboratory to pilot plant: the solid-state process development of a highly potent cathepsin S/K inhibitor. Eur J Pharm Biopharm. 2013 Apr;83(3):436-48. | ||||
| Ref 535267 | Baculoviral expression and characterization of rodent cathepsin S. Protein Expr Purif. 2001 Oct;23(1):45-54. | ||||
| Ref 535523 | Cathepsin S inhibitor prevents autoantigen presentation and autoimmunity. J Clin Invest. 2002 Aug;110(3):361-9. | ||||
| Ref 543601 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2353). | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.

