Target Information
Target General Infomation | |||||
---|---|---|---|---|---|
Target ID |
T79068
|
||||
Former ID |
TTDS00384
|
||||
Target Name |
Enoyl-[acyl-carrier-protein] reductase [NADH]
|
||||
Gene Name |
inhA
|
||||
Synonyms |
InhA; NADH-dependent enoyl-ACP reductase; Fatty acid synthetase I; inhA
|
||||
Target Type |
Successful
|
||||
Disease | Bacterial infections [ICD9: 001-009, 010-018, 020-027, 030-041, 080-088, 090-099, 100-104; ICD10: A00-B99] | ||||
Malaria [ICD10: B54] | |||||
Mycobacterium tuberculosis infection [ICD10: A15-A19] | |||||
Tuberculosis [ICD9: 010-018; ICD10: A15-A19] | |||||
Function |
Involved in the resistance against the antituberculosis drugs isoniazid and ethionamide.
|
||||
BioChemical Class |
Oxidoreductases acting on CH-CH group of donors
|
||||
Target Validation |
T79068
|
||||
UniProt ID | |||||
EC Number |
EC 1.3.1.9
|
||||
Sequence |
MTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPL
LELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVSKGI HISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAREAG KYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATPVAK TVCALLSDWLPATTGDIIYADGGAHTQLL |
||||
Structure |
1BVR; 1ENY; 1ENZ; 1P44; 1P45; 1ZID; 2AQ8; 2AQH; 2AQI; 2AQK; 2B35; 2B36; 2B37; 2H9I; 2IDZ; 2IE0; 2IEB; 2IED; 2NSD; 2NTJ; 2NV6; 2PR2; 2X22; 2X23; 3FNE; 3FNF; 3FNG; 3FNH; 3OEW; 3OEY; 3OF2; 4BGE; 4BGI; 4BII; 4BQP; 4BQR; 4DQU; 4DRE; 4DTI; 4OHU; 4OXK; 4OXN; 4OXY; 4OYR; 4TRJ; 4TZK; 4TZT; 4U0J; 4U0K
|
||||
Drugs and Mode of Action | |||||
Drug(s) | Ethionamide | Drug Info | Approved | Tuberculosis | [536472], [551871] |
Isoniazid | Drug Info | Approved | Tuberculosis | [536472] | |
Prothionamide | Drug Info | Approved | Tuberculosis | [536338] | |
Pyrazinamide | Drug Info | Approved | Mycobacterium tuberculosis infection | [536472], [542307], [551871] | |
AFN-1720 | Drug Info | Phase 2 | Bacterial infections | [549502] | |
MMV00/0053 | Drug Info | Terminated | Malaria | [551156] | |
Inhibitor | (4-benzylpiperidin-1-yl)(2-fluorophenyl)methanone | Drug Info | [528999] | ||
(4-benzylpiperidin-1-yl)(3-chlorophenyl)methanone | Drug Info | [528999] | |||
(4-benzylpiperidin-1-yl)(m-tolyl)methanone | Drug Info | [528999] | |||
(4-benzylpiperidin-1-yl)(p-tolyl)methanone | Drug Info | [528999] | |||
(4-phenylpiperazin-1-yl)(p-tolyl)methanone | Drug Info | [528999] | |||
2-(2-aminophenoxy)-5-hexylphenol | Drug Info | [529452] | |||
2-(3-aminophenoxy)-5-hexylphenol | Drug Info | [529452] | |||
2-(4,6-dimethoxypyrimidin-2-yloxy)-5-hexylphenol | Drug Info | [529452] | |||
2-(4-aminophenoxy)-5-hexylphenol | Drug Info | [529452] | |||
2-(4-hexyl-2-methoxyphenoxy)pyrimidine | Drug Info | [529452] | |||
2-bromo-4-methylphenyl 2-nitrobenzoate | Drug Info | [530118] | |||
2-Hexadecynoic acid | Drug Info | [531170] | |||
2-nitro-N-(2,4,5-trichlorophenyl)benzamide | Drug Info | [530118] | |||
4-(2-Thienyl)-1-(4-Methylbenzyl)-1h-Imidazole | Drug Info | [551393] | |||
4-chloro-N-(2,5-dichlorophenyl)-3-nitrobenzamide | Drug Info | [530118] | |||
5-hexyl-2-(2-nitrophenoxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(3-nitrophenoxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(4-nitrophenoxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(pyrazin-2-yloxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(pyridin-2-yloxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(pyridin-3-yloxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(pyridin-4-yloxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-(pyrimidin-2-yloxy)phenol | Drug Info | [529452] | |||
5-hexyl-2-phenoxyphenol | Drug Info | [529452] | |||
5-octyl-2-phenoxyphenol | Drug Info | [529404] | |||
5-PENTYL-2-PHENOXYPHENOL | Drug Info | [551374] | |||
AFN-1720 | Drug Info | [551768] | |||
Beta-D-Glucose | Drug Info | [551393] | |||
C16-Fatty-Acyl-Substrate-Mimic | Drug Info | [551393] | |||
Diclosan | Drug Info | [551393] | |||
Ethionamide | Drug Info | [536338], [536947] | |||
Genz-10850 | Drug Info | [551393] | |||
Indole Naphthyridinone | Drug Info | [551393] | |||
Isoniazid | Drug Info | [536367], [536368], [537025] | |||
MMV00/0053 | Drug Info | [530687] | |||
N-(2,4-dichlorophenyl)-2-nitrobenzamide | Drug Info | [530118] | |||
N-(2,4-dichlorophenyl)-4-methyl-3-nitrobenzamide | Drug Info | [530118] | |||
N-(2,4-dimethylphenyl)-2-nitrobenzamide | Drug Info | [530118] | |||
N-(2,5-dichlorophenyl)-4-methoxy-3-nitrobenzamide | Drug Info | [530118] | |||
N-(2-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide | Drug Info | [529452] | |||
N-(3,5-dichlorophenyl)-2-nitrobenzamide | Drug Info | [530118] | |||
N-(3,5-dichlorophenyl)-4-methoxy-3-nitrobenzamide | Drug Info | [530118] | |||
N-(3,5-dimethoxyphenyl)-4-methyl-2-nitrobenzamide | Drug Info | [530118] | |||
N-(3-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide | Drug Info | [529452] | |||
N-(4-(4-hexyl-2-hydroxyphenoxy)phenyl)acetamide | Drug Info | [529452] | |||
N-(4-(diethylamino)phenyl)-2-nitrobenzamide | Drug Info | [530118] | |||
N-(4-METHYLBENZOYL)-4-BENZYLPIPERIDINE | Drug Info | [551374] | |||
Nicotinamide-Adenine-Dinucleotide | Drug Info | [551393] | |||
Prothionamide | Drug Info | [536338], [537658] | |||
Pyrazinamide | Drug Info | [535045] | |||
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
DRM | DRM Info | ||||
References | |||||
Ref 536338 | Mechanism of thioamide drug action against tuberculosis and leprosy. J Exp Med. 2007 Jan 22;204(1):73-8. Epub 2007 Jan 16. | ||||
Ref 536472 | Novel agents in the management of Mycobacterium tuberculosis disease. Curr Med Chem. 2007;14(18):2000-8. | ||||
Ref 542307 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7287). | ||||
Ref 528999 | Bioorg Med Chem. 2007 Nov 1;15(21):6649-58. Epub 2007 Aug 15.Inhibition of the Mycobacterium tuberculosis enoyl acyl carrier protein reductase InhA by arylamides. | ||||
Ref 529404 | J Med Chem. 2008 May 8;51(9):2606-12. Epub 2008 Apr 5.Natural products, small molecules, and genetics in tuberculosis drug development. | ||||
Ref 529452 | Bioorg Med Chem Lett. 2008 May 15;18(10):3029-33. Epub 2008 Apr 18.Synthesis and in vitro antimycobacterial activity of B-ring modified diaryl ether InhA inhibitors. | ||||
Ref 530118 | Eur J Med Chem. 2009 Sep;44(9):3718-30. Epub 2009 Apr 8.Discovery of potential new InhA direct inhibitors based on pharmacophore and 3D-QSAR analysis followed by in silico screening. | ||||
Ref 530687 | SAR and pharmacophore models for the rhodanine inhibitors of Plasmodium falciparum enoyl-acyl carrier protein reductase. IUBMB Life. 2010 Mar;62(3):204-13. | ||||
Ref 531170 | Bioorg Med Chem. 2010 Nov 1;18(21):7475-85. Epub 2010 Sep 18.2-Hexadecynoic acid inhibits plasmodial FAS-II enzymes and arrests erythrocytic and liver stage Plasmodium infections. | ||||
Ref 535045 | Pyrazinamide inhibits the eukaryotic-like fatty acid synthetase I (FASI) of Mycobacterium tuberculosis. Nat Med. 2000 Sep;6(9):1043-7. | ||||
Ref 536338 | Mechanism of thioamide drug action against tuberculosis and leprosy. J Exp Med. 2007 Jan 22;204(1):73-8. Epub 2007 Jan 16. | ||||
Ref 536367 | Screening for novel antituberculosis agents that are effective against multidrug resistant tuberculosis. Curr Top Med Chem. 2007;7(5):499-507. | ||||
Ref 536368 | Enoyl reductases as targets for the development of anti-tubercular and anti-malarial agents. Curr Drug Targets. 2007 Mar;8(3):399-411. | ||||
Ref 536947 | Calcium-activated conductance in skate electroreceptors: current clamp experiments. J Gen Physiol. 1977 Feb;69(2):121-43. | ||||
Ref 537025 | Diversity in enoyl-acyl carrier protein reductases. Cell Mol Life Sci. 2009 May;66(9):1507-17. |
If you find any error in data or bug in web service, please kindly report it to Dr. Tang and Dr. Mou.